SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011548 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011548
Domain Number 1 Region: 3-160
Classification Level Classification E-value
Superfamily E set domains 3.78e-18
Family Arrestin/Vps26-like 0.029
Further Details:      
 
Domain Number 2 Region: 159-336
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000455
Family Arrestin/Vps26-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011548   Gene: ENSGGOG00000011838   Transcript: ENSGGOT00000011883
Sequence length 391
Comment pep:known_by_projection chromosome:gorGor3.1:1:125114392:125118568:1 gene:ENSGGOG00000011838 transcript:ENSGGOT00000011883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMFKKIKSFEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGS
QQCKQTSEYLRYEDTLLLEDQPTGESEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGC
VDYWVKAFLDRPSQPTQETKKNFEVVDLVDVNTPDLMAPVSAKKEKKVSCMFIPDGRVSV
SARIDRKGFCEGDEISIHADFENTCSRIVVPKAAIVARHTYLANGQTKVLTQKLSSVRGN
HIISGTCASWRGKSLRVQKIRPSILGCNILRVEYSLLIYVSVPGSKKVILDLPLVIGSRS
GLSSRTSSMASRTSSEMSWVDLNIPDTPEAPPCYMDVIPEDHRLESPTTPLLDDMDGSQD
SPIFMYAPEFKFMPPPTYTEVDPCILNNNVQ
Download sequence
Identical sequences G3R848
XP_004026528.1.27298 ENSGGOP00000011548 ENSGGOP00000011548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]