SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011557 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011557
Domain Number 1 Region: 5-135
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.21e-37
Family Dual specificity phosphatase-like 0.0011
Further Details:      
 
Domain Number 2 Region: 177-244
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.00000117
Family Interferon regulatory factor 3 (IRF3), transactivation domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011557   Gene: ENSGGOG00000011846   Transcript: ENSGGOT00000011892
Sequence length 295
Comment pep:known_by_projection chromosome:gorGor3.1:20:29140176:29166182:-1 gene:ENSGGOG00000011846 transcript:ENSGGOT00000011892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEGVLPGLYLGNFIDAKDLDQLGRNKITHIISIHESPQPLLQDITYLRIPVADTPEVPI
KKHFKECINFIHCCRLNGGNCLVHCFAGISRSTTIVTAYVMTVTGLGWRDVLEAIKATRP
IANPNPGFRQQLEEFGWASSRKGARHRTPKTPGAQCPPMTSATCLLAARVALLSAALVRE
ATGRTAQRCRLSPRAAAERLLGPPPHVAAGWSPDPKYQICLCFGEEDPGPTEHPKEQLIM
ADVQVQLRPGSSSCTLSASTERPEGSSTPGNPDGITHLQRSCLHPKRAAYSSCTR
Download sequence
Identical sequences G3R857
XP_004062011.1.27298 ENSGGOP00000011557 ENSGGOP00000011557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]