SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011560 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011560
Domain Number 1 Region: 18-398
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.66e-106
Family Motor proteins 0.0000000000724
Further Details:      
 
Domain Number 2 Region: 584-734
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0000157
Family Apolipoprotein A-I 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011560   Gene: ENSGGOG00000011847   Transcript: ENSGGOT00000011895
Sequence length 933
Comment pep:known_by_projection chromosome:gorGor3.1:10:105745094:105806730:1 gene:ENSGGOG00000011847 transcript:ENSGGOT00000011895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASQPNSSAKKKEEKGKNIQVVVRCRPFNLAERKASAHSIVECDPVRKEVSVRTGGLADK
SSRKTYTFDMVFGASTKQIDVYRSVVCPILDEVIMGYNCTIFAYGQTGTGKTFTMEGERS
PNEEYTWEEDPLAGIIPRTLHQIFEKLTDNGTEFSVKVSLLEIYNEELFDLLNPSSDVSE
RLQMFDDPRNKRPLIIALELTLHNNDGVNIILEKGSAKMTTAVALVKDDYIRSHSVFSVT
IHMKETTIDGEELVKIGKLNLVDLAGSENIGRSGAVDKRAREAGNINQSLLTLGRVITAL
VERTPHVPYRESKLTRILQDSLGGRTRTSIIATISPASLNLEETLSTLEYAHRAKNILNK
PEVNQKLTKKALIKEYTEEIERLKRDLAAAREKNGVYISEENFRVMSGKLTVQEEQIVEL
IEKIGAVEEELNRLLNTVEETTKDVSGLHSKLDRKKAVDQHNAEAQDIFGKNLNSLFNNM
EELIKDGSSKQKAMLEVHKTLFNVLKTDLLSSLEMILSPTVVSILKINSQLKHIFKTSLT
VADKIEDQKKELDGFLSILCNNLHELQENTICSLVESQKQCGNLTEDLKTIKQTHSQELC
KLMNLWTERFCALEEKCENIQKPLSSVQENIQQKSKDIVNKMTFHSQKFCADSDGFSQEL
RNFNQEGTKLVEESVKHSDKLNGNLEKISQETEQRCESLNTRTVYFSEQWVSSLNEREQE
LQNLLEVVSQCCEASSSDITEKSDGRKAAHEKQHNIFLDQMTIDEDKLIAQNLELNETIK
IGLTKLNCFLEQDLKLDIPTGTTPQRKSYLYPSTLVRTEPREHLLDQLKRKQPELLMMLN
CSENNKEETIPDVDVEEAVLGQYTEEPLSQEPSVDAGVDCSSIGGVPFFQHKKSHGKDKE
NRGINTLERSKVEETTEHLVTKSRLPLRAQINL
Download sequence
Identical sequences ENSGGOP00000011560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]