SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011565 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011565
Domain Number 1 Region: 194-348
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 3.23e-47
Family Glycerol-3-phosphate dehydrogenase 0.00092
Further Details:      
 
Domain Number 2 Region: 2-193
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.03e-44
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011565   Gene: ENSGGOG00000011860   Transcript: ENSGGOT00000011900
Sequence length 350
Comment pep:known_by_projection chromosome:gorGor3.1:12:48059140:48066432:1 gene:ENSGGOG00000011860 transcript:ENSGGOT00000011900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMASKKVCIVGSGNWGSAIAKIVGGNAAQLAQFDPRVTMWVFEEDIGGKKLTEIINTQHE
NVKYLPGHKLPPNVVAVPDVVQAAEDADILIFVVPHQFIGKICDQLKGHLKANATGISLI
KGVDEGPNGLKLISEVIGERLGIPMSVLMGANIASEVADEKFCETTIGCKDPAQGQLLKE
LMQTPNFRITVVQEVDTVEICGALKNVVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFA
KVFCSGPVSSATFLESCGVADLITTCYGGRNRKVAEAFARTGKSIEQLEKELLNGQKLQG
PETARELHSILQHKGLVDKFPLFMAVYKVCYEGQPVGEFIHCLQNHPEHM
Download sequence
Identical sequences ENSGGOP00000011565 ENSGGOP00000011565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]