SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011570 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011570
Domain Number 1 Region: 294-465
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.1e-75
Family Mammalian PLC 0.00000473
Further Details:      
 
Domain Number 2 Region: 179-293
Classification Level Classification E-value
Superfamily EF-hand 1.32e-33
Family EF-hand modules in multidomain proteins 0.00072
Further Details:      
 
Domain Number 3 Region: 583-703
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.09e-28
Family PLC-like (P variant) 0.00013
Further Details:      
 
Domain Number 4 Region: 19-132
Classification Level Classification E-value
Superfamily PH domain-like 1.01e-26
Family Pleckstrin-homology domain (PH domain) 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011570   Gene: ENSGGOG00000011858   Transcript: ENSGGOT00000011905
Sequence length 712
Comment pep:known_by_projection chromosome:gorGor3.1:2b:107545465:107565928:1 gene:ENSGGOG00000011858 transcript:ENSGGOT00000011905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PATLSAGYLTPAFPDLELTTDQDLLLMQEGMPMRKVRSKSWKKLRYFRLQNDGMTVWHAR
QARGSAKPSFSISDVETIRNGHDSELLRSLAEELPLEQGFTVVFHGRRSNLDLVANSVEE
AQIWMRGLQLLVDLVTSMDHQERLDQYRQDGVRVGKKKEKEKSLFYERFPIKRFIHSPLN
PLLQAADTSQSGTLEGEEFVQFYKALTKRAEVQELFESFSADGQKLTLLEFLDFLREKQK
ERDCTSELALELIDRYEPSDSGKLRHVLSMDGFLSYLCSKDGDIFNPACLPIYQDMTQPL
NHYFICSSHNTYLVGDQLCGQSSVEGYIRALKRGCRCVEVDVWDGPSGEPVVYHGHTLTS
RILFKDVVATVAQYAFQTSDYPVILSLETHCSWEQQQTMARHLTEILGEQLLSTTLDGVL
PTQLPSPEELRRKILVKAKKLTFEEDLEYEEEEAEHELEESELALESQFAHELMPQEHSI
VYEFKTRVTQARSLCCAEGLFMNTRSVQDEGPMSNNSSCQEWRLEGTTRASIHMQVAGAF
HIFCGTLYHLNTRRKYITHGGCFTNQKASSPLGLGVGSGGAGVISGQQLPKVDKTKEGSI
VDPLVKVQIFGVRLDTARQETNYVENNGFNPYWGQTLCFRVLVPELAMLRFVVMDYDWKS
RNDFIGQYTLPWTCMQQGYRHIHLLSKDGISLRPASIFVYICIQEGLEGDES
Download sequence
Identical sequences ENSGGOP00000011570 ENSGGOP00000011570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]