SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011589 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011589
Domain Number 1 Region: 119-367
Classification Level Classification E-value
Superfamily vWA-like 7.56e-82
Family Integrin A (or I) domain 0.0000000228
Further Details:      
 
Domain Number 2 Region: 363-452
Classification Level Classification E-value
Superfamily Integrin domains 2.56e-30
Family Integrin domains 0.0001
Further Details:      
 
Domain Number 3 Region: 619-701
Classification Level Classification E-value
Superfamily Integrin beta tail domain 8.89e-19
Family Integrin beta tail domain 0.00033
Further Details:      
 
Domain Number 4 Region: 12-64
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000377
Family Plexin repeat 0.00077
Further Details:      
 
Domain Number 5 Region: 578-618
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000103
Family Integrin beta EGF-like domains 0.0032
Further Details:      
 
Domain Number 6 Region: 535-573
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000053
Family Integrin beta EGF-like domains 0.013
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000011589
Domain Number - Region: 504-535
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0363
Family Integrin beta EGF-like domains 0.031
Further Details:      
 
Domain Number - Region: 460-487
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0614
Family Integrin beta EGF-like domains 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011589   Gene: ENSGGOG00000011869   Transcript: ENSGGOT00000011924
Sequence length 785
Comment pep:known_by_projection chromosome:gorGor3.1:3:124455290:124579754:-1 gene:ENSGGOG00000011869 transcript:ENSGGOT00000011924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCALLPRLAGLNICTGGSATSCEECLLIHPKCAWCSKEDFGSPRSITSRCDLRANLVRNG
CGGEIESPASSFHVLRSLPLSSKGSGSAGWDVIQMTPQEIAVNLRPGDKTTFQLQVRQVE
DYPVDLYYLMDLSLSMKDDLDNIRSLGTKLAEEMRKLTSNFRLGFGSFVDKDISPFSYTA
PRYQTNPCIGYKLFPNCVPSFGFRHLLPLTDRVDSFNEEVRKQRVSRNRDAPEGGFDAVL
QAAVCKEKIGWRKDALHLLVFTTDDVPHIALDGKLGGLVQPHDGQCHLNEANEYTASNQM
DYPSLALLGEKLAENNINLIFAVTKNHYMLYKNFTALIPGTTVEILDGDSKNIIQLIINA
YNSIRSKVELSVWDQPEDLNLFFTATCQDGVSYPGQRKCEGLKIGDTASFEVSVEARSCP
SRHTEHVFALRPVGFRDSLEVGVTYNCTCGCSVGLEPNSARCSGSGTYVCGLCECSPGYL
GTRCECQDGENQSVYQNLCREAEGKPLCSGRGDCSCNQCSCFESEFGKIYGPFCECDNFS
CARNKGVLCSGHGECHCGECKCHAGYIGDNCNCSTDISTCRGRDGQICSERGHCLCGQCQ
CTEPGAFGEMCEKCPTCPDACSTKRDCVECLLLHSGKPDNQTCHSLCRDEVITWVDTIVK
DDQEAVLCFYKTAKDCVMMFTYVELPSGKSNLTVLREPECGNTPNAMTILLAVVGSILLV
GLALLAIWKLLVTIHDRREFAKFQSERSRARYEMASNPLYRKPISTHTVDFTFSKFNKSY
NGTVD
Download sequence
Identical sequences G3R885
ENSGGOP00000011589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]