SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011606 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011606
Domain Number 1 Region: 116-556
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.09e-108
Family Amylase, catalytic domain 0.00000047
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000011606
Domain Number - Region: 569-650
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0136
Family alpha-Amylases, C-terminal beta-sheet domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011606   Gene: ENSGGOG00000011896   Transcript: ENSGGOT00000011942
Sequence length 685
Comment pep:known_by_projection chromosome:gorGor3.1:2a:44991827:45040164:1 gene:ENSGGOG00000011896 transcript:ENSGGOT00000011942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEDKSKRDSIEMSMKGCQTNNGFVHNEDILEQTPDPGSSTDNLKHSTRSILGSQEPDFK
GVQPYAGMPKEVLFQFSGQARYRIPREILFWLTVASVLVLIAATIAIIALSPKCLDWWQE
GPMYQIYPRSFKDSNKDGNGDLKGIQDKLDYITALNIKTVWITSFYKSSLKDFRYGVEDF
REVDPIFGTMEDFENLVAAIHDKGLKLIIDFIPNHTSDKHTWFQLSRTRTGKYTDYYIWH
DCTHENGKTIPPNNWLSVYGNSSWHFDEVRNQCYFHQFMKEQPDLNFRNPDVQEEIKEIL
QFWLTKGVDGFSFDAVKFLLEAKHLRDEIQVNKTQIPDTVTQYSELYHDFTTTQVGMHDI
VRSFRQTMDQYSTEPGRYRFMGTEAYAESIDRTVMYYGLPFIQEADFPFNNYLTMLDTVS
GNSVYEVITSWMENMPEGKWPNWMIGGPDSSRLTSRLGNEYVNVMNMLLFTLPGTPITYY
GEEIGMGNIVATNLNESYDINTLRSKSPMQWDNSSNAGFSEASHTWLPTNSDYHTVNVDV
QKTQPRSALKLYQDLSLLHANELLLNRGWFCHLRNDSHYVVYTRELDGIDRIFIVVLNFG
ESTLLNLHNMISGLPATMRIRLSTNSANKGSKVDTSGIFLDKGEGLIFEHNTKNLLHRQT
AFRDRCFVSNRACYSSVLNILYTSC
Download sequence
Identical sequences ENSGGOP00000011606 ENSGGOP00000011606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]