SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011621 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011621
Domain Number 1 Region: 188-269,319-385
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000608
Family Calmodulin-like 0.05
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000011621
Domain Number - Region: 470-528
Classification Level Classification E-value
Superfamily EF-hand 0.0342
Family Penta-EF-hand proteins 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011621   Gene: ENSGGOG00000011908   Transcript: ENSGGOT00000011957
Sequence length 546
Comment pep:known_by_projection chromosome:gorGor3.1:1:61925612:62005826:-1 gene:ENSGGOG00000011908 transcript:ENSGGOT00000011957 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSAGKTPRGSDAMPEIMVKIIGSKHFQYLVEKPKIKENDSLKTETQTMHQKPMTDNARQ
MSRDTPVPINFTDQQTNDNPDDVKEKKHPENNQKSENNQKLLTGANSSRFLDGNIPSQAN
VHCSSVPTGDQSLSYVHGVPRRKLRDWSLEQMVRGSSDQPEDIGQSPSGTTNEDAFLLAL
VRRELKSRPLSSNLLEKLQKELKILDPISSGFLLQSQLSHLFLKHEVPLQLPTVKILCQR
FSKRGSPEMVNYEKLLWFLNSAASDYPQQNKAAADLRKTESHGTHSQSTPPQHSSSQPEV
NRSLLEILKMALRTTNGRLNIDNLNLSFRKEDRSFSGCLPPPKVRAICGKHGLYLTLSLL
ETLLNHQDFSYQNEIKWQNFVEMLTRASSDLLSDLPTGKNEKKAPAPPMEPEVPEMSQSK
TEHMKTPEEELQPESSPAETSACKDPLKPLKIRPVSQPFVNPAVKNKAEECETWIDRFRK
LENALYLCDLSNTGVLEKERARRLIHNYNLIYNLSLSPQKIDQALRRFRSGENMLLEPAL
RYLKEL
Download sequence
Identical sequences ENSGGOP00000011621 ENSGGOP00000011621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]