SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011629 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011629
Domain Number 1 Region: 18-259
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.39e-87
Family Calponin-homology domain, CH-domain 0.0000251
Further Details:      
 
Domain Number 2 Region: 277-399
Classification Level Classification E-value
Superfamily Spectrin repeat 2.22e-34
Family Spectrin repeat 0.000000247
Further Details:      
 
Domain Number 3 Region: 513-634
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-32
Family Spectrin repeat 0.000000463
Further Details:      
 
Domain Number 4 Region: 394-509
Classification Level Classification E-value
Superfamily Spectrin repeat 7.85e-24
Family Spectrin repeat 0.000000481
Further Details:      
 
Domain Number 5 Region: 638-749
Classification Level Classification E-value
Superfamily Spectrin repeat 1.27e-22
Family Spectrin repeat 0.000000565
Further Details:      
 
Domain Number 6 Region: 742-870
Classification Level Classification E-value
Superfamily EF-hand 4.16e-22
Family EF-hand modules in multidomain proteins 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011629   Gene: ENSGGOG00000011905   Transcript: ENSGGOT00000011966
Sequence length 897
Comment pep:known_by_projection chromosome:gorGor3.1:1:217000953:217076228:1 gene:ENSGGOG00000011905 transcript:ENSGGOT00000011966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSAMNQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGT
QIENIEEDFRNGLKLMLLLEVISGERLPKPDRGKMRFHKIANVNKALDYIASKGVKLVSI
GAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNIQNFH
TSWKDGLGLCALIHRHRPDLIDYSKLNKDDPIGNINLAMEIAEKHLDIPKMLDAEDIVNT
PKPDERAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENERLMEEYERLASELLEWI
RRTIPWLENRTPEKTMQAMQKKLEDFRDYRRKHKPPKVQEKCQLEINFNTLQTKLRISNR
PAFMPSEGKMVSDIAGAWQRLEQAEKGYEEWLLNEIRRLERLEHLAEKFRQKASTHETWA
YGKEQILLQKDYESASLTEVRALLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAV
NVNDRCQKICDQWDRLGTLTQKRREALERMEKLLETIDQLHLEFAKRAAPFNNWMEGAME
DLQDMFIVHSIEEIQSLITAHEQFKATLPEADGERQSIMAIQNEVEKVIQSYNIRISSSN
PYSTVTMDELRTKWDKVKQLVPIRDQSLQEELARQHANERLRRQFAAQANAIGPWIQNKM
EEIARSSIQITGALEDQMNQLKQYEHNIINYKNNIDKLEGDHQLIQEALVFDNKHTNYTM
EHIRVGWELLLTTIARTINEVETQILTRDAKGITQEQMNEFRASFNHFDRRKNGLMDHED
FRACLISMGYDLGEAEFARIMTLVDPNGQGTVTFQSFIDFMTRETADTDTAEQVIASFRI
LASDKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALDYTAFSSALYGESDL
Download sequence
Identical sequences ENSGGOP00000011629 ENSGGOP00000011629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]