SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011641 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011641
Domain Number 1 Region: 119-240
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.4e-33
Family cAMP-binding domain 0.00000113
Further Details:      
 
Domain Number 2 Region: 248-372
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.96e-32
Family cAMP-binding domain 0.000000843
Further Details:      
 
Domain Number 3 Region: 15-62
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 1.83e-18
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011641   Gene: ENSGGOG00000011929   Transcript: ENSGGOT00000011978
Sequence length 381
Comment pep:known_by_projection chromosome:gorGor3.1:7:454717:631029:-1 gene:ENSGGOG00000011929 transcript:ENSGGOT00000011978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPPACPSEEDESLKGCELYVQLHGIQQVLKDCIVHLCISKPERPMKFLREHFEKLEKE
ENRQILARQKSNSQSDSHDEEVSPTPPNPVVKARRRRGGVSAEVYTEEDAVSYVRKVIPK
DYKTMTALAKAISKNVLFAHLDDNERSDIFDAMFPVTHIAGETVIQQGNEGDNFYVIDQG
EVDVYVNGEWVTNISEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTL
RKRKMYEEFLSKVSILESLEKWERLTVADALEPVQFEDGEKIVVQGEPGDDFYIITEGTA
SVLQRRSPNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLG
PCSEILKRNIQRYNSFISLTV
Download sequence
Identical sequences A0A2J8SR39 A0A2K6SYT4 G3R8D7 K7B4J4
ENSGGOP00000011641 ENSGGOP00000011641 XP_003819754.1.60992 XP_003819755.1.60992 XP_003943806.1.74449 XP_004045042.1.27298 XP_004045043.1.27298 XP_010329943.1.74449 XP_016801591.1.37143 XP_016801592.1.37143 XP_016801593.1.37143 XP_016801594.1.37143 XP_016801595.1.37143 XP_016801597.1.37143 XP_016801598.1.37143 XP_016801599.1.37143 XP_016801600.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]