SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011650 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011650
Domain Number 1 Region: 37-273
Classification Level Classification E-value
Superfamily Nqo1 FMN-binding domain-like 7.72e-86
Family Nqo1 FMN-binding domain-like 0.000000346
Further Details:      
 
Domain Number 2 Region: 360-452
Classification Level Classification E-value
Superfamily Nqo1C-terminal domain-like 3.4e-35
Family Nqo1C-terminal domain-like 0.0002
Further Details:      
 
Domain Number 3 Region: 274-358
Classification Level Classification E-value
Superfamily Nqo1 middle domain-like 2.88e-22
Family Nqo1 middle domain-like 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011650   Gene: ENSGGOG00000011943   Transcript: ENSGGOT00000011987
Sequence length 464
Comment pep:known chromosome:gorGor3.1:11:64515361:64521023:1 gene:ENSGGOG00000011943 transcript:ENSGGOT00000011987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLATRRLLSWSLPARVSVRFSGDTTAPKKTSFGSLKDEDRIFTNLYGRHDWRLKGALSRG
DWYKTKEILLKGPDWILGEIKTSGLRGRGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEG
EPGTCKDREILRHDPHKLVEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVAIREAYEAG
LIGKNACGSGYDFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPT
TVANVETVAVSPTICRRGGTWFSGFGRERNSGTKLFNISGHVNHPCTVEEEMSVPLKELI
EKHAGGVTGGWENLLAVIPGGSSTPLIPKSVCETVLMDFDALVQAQTGLGTAAVIVMDRS
TDIVKAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVRGDARPAEIDSLWEISKQIE
GHTICALGDGAAWPVQGLIRHFRPELEERMQRFAQQHQARQAAS
Download sequence
Identical sequences Q0MQI5
NP_001266473.1.27298 ENSGGOP00000011650 ENSGGOP00000011650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]