SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011664 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011664
Domain Number 1 Region: 236-303
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 9.5e-16
Family Splicing factor U2AF subunits 0.041
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000011664
Domain Number - Region: 167-192
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000301
Family CCCH zinc finger 0.0051
Further Details:      
 
Domain Number - Region: 302-330
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00068
Family CCCH zinc finger 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011664   Gene: ENSGGOG00000011962   Transcript: ENSGGOT00000012002
Sequence length 440
Comment pep:known_by_projection chromosome:gorGor3.1:X:15756921:15776951:1 gene:ENSGGOG00000011962 transcript:ENSGGOT00000012002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPEKMTFPEKPSHKKYRAALKKEKRKKRRQELARLRDSAPPPKEEEEDTFIEEQQLEE
EKLLERERQRLHEEWLLREQKAQEEFRIKKEKEEAAKKRQEEQERFFPDEEICETLRRNE
GNEIDSKLMKKNQQYVTTNKQLDQLENGTTWQNPEPPVDFRVMEKDRANCPFYSKTGACR
FGDRCSRKHNFPTSSPTLLIKSMFTTFGMEQCRRDDYDPDASLEYSEEETYQQFLDFYED
VLPEFKNVGKVIQFKVSCNLEPHLRGNVYVQYQSEEECQAALSLFNGRWYAGRQLQCEFC
PVTRWKMAICGLFEIQQCPRGKHCNFLHVFRNPNNEFWEANRDIYLSPDQTGSSFGKNSE
RREKMGHHDHYYSRQRGRRNPSPDHSYKRNGESERKKSSHRGKKSHKRTSKSRERHNSPS
RGRNRHRSWDQGRRSQSRRS
Download sequence
Identical sequences ENSGGOP00000011664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]