SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011667 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011667
Domain Number 1 Region: 51-162
Classification Level Classification E-value
Superfamily HIT-like 2.17e-38
Family HIT (HINT, histidine triad) family of protein kinase-interacting proteins 0.00000117
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011667   Gene: ENSGGOG00000011967   Transcript: ENSGGOT00000012005
Sequence length 163
Comment pep:known_by_projection chromosome:gorGor3.1:5:114527411:114533600:-1 gene:ENSGGOG00000011967 transcript:ENSGGOT00000012005 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PEPGHLRRLGCALSRRTLCGFHPSSELLWPPRGREDEMADEIAKAQVARPGGDTIFGKII
RKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKK
CAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG
Download sequence
Identical sequences ENSGGOP00000011667 ENSGGOP00000011667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]