SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011690 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011690
Domain Number 1 Region: 24-141,190-224,253-292
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.27e-20
Family DNA gyrase/MutL, N-terminal domain 0.044
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000011690
Domain Number - Region: 839-884
Classification Level Classification E-value
Superfamily Moesin tail domain 0.00314
Family Moesin tail domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011690   Gene: ENSGGOG00000011974   Transcript: ENSGGOT00000012028
Sequence length 941
Comment pep:known_by_projection chromosome:gorGor3.1:21:24764229:24820022:1 gene:ENSGGOG00000011974 transcript:ENSGGOT00000012028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAQPPRGIRLSALCPKFLHTNSTSHTWPFSAVAELIDNAYDPDVNAKQIWIDKTVINDH
ICLTFTDNGNGMTSDKLHKMLSFGFSDKVTMNGHVPVGLYGNGFKSGSMRLGKDAIVFTK
NGESMSVGLLSQTYLEVIKAEHVVVPIVAFNKHDIRQMINLAESKASLAAILEHSLFSTE
QKLLAELDAIIGKKGTRIIIWNLRSYKNATEFDFEKDKYDIRIPEDLDEITGKKGYKKQE
RMDQIAPESDYSLRAYCSILYLKPRMQIILRGQKVKTQLVSKSLAYIERDVYRPKFLSKT
VRITFGFNCRNKDHYGIMMYHRNRLIKAYEKVGCQLRANNMGVGVVGIIECNFLKPTHNK
QDFDYTNEYRLTITALGEKLNDYWNEMKVKKNTEYPLNLPVEDIQKRPDQTWVQCDACLK
WRKLPDGMDQLPEKWYCSNNPDPQFRNCEVPEEPEDEDLVHPTYEKTYKKTNKEKFRIRQ
PEMIPRINAELLFRPTALSTPSFSSPKESVPRRHLSEGTNSYATRLLNNHQISAQSEPES
NSLKRRLSTRSSILNAKNRRLSSQFENSVYKGDDDDEDVIILEENSTPKPAVDHDIDMKS
EQSHVEQGGVQVELVGDSEPCGQTGSTSTSSSRCDQGNTAATQTEVPSLVVKKEETVEDE
IDVRNDAVILPSCVEAEAKIHETQETTDKSADDAGCHLQELRNQLLLVTEEKENYKRQCH
MFTDQIKVLQQRILEMNDKYVKKETCHQSTETDAVFLLESINGKSESPDHMVSQYQQALE
EIERLKKQCSALQHVKAECSQCSNNESKSEMDEMAVQLDDVFRQLDKCSIERDQYKSEVE
LLEMEKSQIRSQCEELKTEVEQLKSTNQQTATDVSTSSNIEESVNHMDGESLKLRSLRVN
VGQLLAMIVPDLDLQQVNYDVDVVDEILGQVVEQMSEISST
Download sequence
Identical sequences ENSGGOP00000011690 ENSGGOP00000011690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]