SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011697 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011697
Domain Number 1 Region: 45-190
Classification Level Classification E-value
Superfamily EF-hand 2.71e-37
Family Calmodulin-like 0.00000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011697   Gene: ENSGGOG00000011991   Transcript: ENSGGOT00000012036
Sequence length 192
Comment pep:known_by_projection chromosome:gorGor3.1:2b:98994541:99019409:-1 gene:ENSGGOG00000011991 transcript:ENSGGOT00000012036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPKKDVKKPAAAAAPAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQQDEFKEAFLLF
DRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISN
NKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCI
NYEAFVKHIMSI
Download sequence
Identical sequences G3R8I7 H2QJC2
ENSPTRP00000022020 XP_003807017.1.60992 XP_004033193.1.27298 XP_516064.2.37143 ENSGGOP00000011697 ENSGGOP00000011697 9598.ENSPTRP00000022020 ENSPTRP00000022020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]