SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011703 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011703
Domain Number 1 Region: 25-88
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000584
Family Eukaryotic type KH-domain (KH-domain type I) 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011703   Gene: ENSGGOG00000012001   Transcript: ENSGGOT00000012042
Sequence length 116
Comment pep:known_by_projection chromosome:gorGor3.1:6:73119254:73120322:-1 gene:ENSGGOG00000012001 transcript:ENSGGOT00000012042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQVSKAMLELKAL
ESSDLTEVVVYGSYLYKLRTKWMLQSMAEWHRQRQERGMLKLAEAMNALELGPWMK
Download sequence
Identical sequences A6NC42 G3R8J3 H2R753
9606.ENSP00000359396 gi|70608179|ref|NP_001020461.1| ENSGGOP00000011703 ENSP00000359396 ENSPTRP00000049915 ENSGGOP00000011703 GO.79139 ENSP00000359396 ENSPTRP00000049915 NP_001020461.1.87134 NP_001020461.1.92137 XP_003311448.1.37143 XP_003809581.1.60992 XP_004044337.1.27298 XP_016811345.1.37143 ENSP00000359396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]