SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011717 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011717
Domain Number 1 Region: 247-464
Classification Level Classification E-value
Superfamily SMAD/FHA domain 8.2e-69
Family Interferon regulatory factor 3 (IRF3), transactivation domain 0.00029
Further Details:      
 
Domain Number 2 Region: 13-122
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.62e-39
Family Interferon regulatory factor 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011717   Gene: ENSGGOG00000012013   Transcript: ENSGGOT00000012057
Sequence length 499
Comment pep:known_by_projection chromosome:gorGor3.1:7:127069666:127081573:1 gene:ENSGGOG00000012013 transcript:ENSGGOT00000012057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQSIPVAPTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFCIPWRHATRHGPSQDGD
NTIFKAWAKETGKYTEGVDEADPAKWKANLRCALNKSRDFRLIYDGPRDMPPQPYKIYEV
CSNGPAPTDSQPPEDYSFGAGEEEEEEEELQRMLPSLSLTDAVQSGPHMTPYSLLKEDVK
WPPTLQLPVVLGPPAPDPSPQAPPPGNPAGFRELLPEVLEPGPLAASLPPAGEQLLPDLL
ISPHMLPLTDLEIKFQYRGRPPRALTISNPHGCRLFYSQLEATQEQVELFGPISLEQVRF
PSPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPCASAHDSYPN
PIQREVKTKLFSLEHFLNELILFQKGQTNTPPPFEIFFCFGEEWPDRKPREKKLITVQVV
PVAARLLLEMFSGELSWSADSIRLQISNPDLKDRMVEQFKELHHIWQSQQRLQPVAQAPP
GAGLGVGQGPWPMHPAGMQ
Download sequence
Identical sequences A0A2I2YFD3
ENSGGOP00000011717 XP_004046242.1.27298 XP_018887319.1.27298 XP_018887320.1.27298 XP_018887321.1.27298 XP_018887322.1.27298 ENSGGOP00000011717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]