SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011720 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011720
Domain Number 1 Region: 31-111
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000242
Family Calmodulin-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011720   Gene: ENSGGOG00000012011   Transcript: ENSGGOT00000012060
Sequence length 147
Comment pep:known_by_projection chromosome:gorGor3.1:6:32508643:32510427:1 gene:ENSGGOG00000012011 transcript:ENSGGOT00000012060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLN
GNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKM
ILMYEEKAREKEKPTGPPAKKAISELP
Download sequence
Identical sequences A0A2K6CS95 G1R2M9 G3R8K9 P55008 Q4V347
ENSP00000365227 ENSP00000372966 ENSP00000391720 ENSP00000397842 ENSP00000398013 ENSP00000416061 ENSNLEP00000007451 ENSNLEP00000007451 9606.ENSP00000365227 GO.33780 ENSGGOP00000011720 gi|14574568|ref|NP_001614.3| ENSGGOP00000011720 NP_001614.3.87134 NP_001614.3.92137 XP_003272151.1.23891 XP_003831631.1.60992 XP_004043704.1.27298 XP_011767198.1.29376 ENSP00000365227 ENSP00000372966 ENSP00000391720 ENSP00000397842 ENSP00000398013 ENSP00000416061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]