SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011739 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011739
Domain Number 1 Region: 20-94
Classification Level Classification E-value
Superfamily PDZ domain-like 1.1e-17
Family PDZ domain 0.00009
Further Details:      
 
Domain Number 2 Region: 495-530
Classification Level Classification E-value
Superfamily WW domain 0.00000000000208
Family WW domain 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000011739
Domain Number - Region: 217-264
Classification Level Classification E-value
Superfamily EF-hand 0.000116
Family Calmodulin-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011739   Gene: ENSGGOG00000012026   Transcript: ENSGGOT00000012079
Sequence length 553
Comment pep:known_by_projection chromosome:gorGor3.1:5:28832771:29028299:-1 gene:ENSGGOG00000012026 transcript:ENSGGOT00000012079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKNTSTVVSPSLLEKDPAFQMITIAKETGLGLKVLGGINRNEGPLVYIQEIIPGGDCYK
DGRLKPGDQLVSVNKESMIGVSFEEAKSIITRAKLRLESAWEIAFIRQKSDNIQPENLSC
TSLIEASGEYGPQASTLSLFSFPPEILIPKTSSTPKTNKAILSSCEIKTGYNKTVQIPIT
SENSTVGLSNTDVASAWTENYGLQEKISLNPSVRFKAEKLEMALNYLGIQPTKEQHQALR
QQVQADSKGTVSFGDFVQVARNLFCLQLDEVNVRAHEISNILDSQLLPCDSSEADEMERL
KCERDDALKEVNTLKEKLLESDKQRKQLTEELQNVKQEAKAVVEETRALRSRIHLAEAAQ
RQAHGMEMDYEEVIRLLEAKITELKAQLADYSDQNKESVQDLKKRIMVLDCQLRKSEMAR
KTFEASTEKLLHFVEAIQEVFSDNSTPLSNLSERRAVLASQTSLTPLGRNGCSIPATLAL
ESKELVKSVRALLDMDCLPYGWEEAYTADGIKYFINHVTQTTSWIHPVMSVLNLSRSEEN
EEDCSRELPNQKS
Download sequence
Identical sequences ENSGGOP00000011739 ENSGGOP00000011739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]