SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011744 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011744
Domain Number 1 Region: 237-263,305-509
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.06e-60
Family Voltage-gated potassium channels 0.00069
Further Details:      
 
Domain Number 2 Region: 109-206
Classification Level Classification E-value
Superfamily POZ domain 2.07e-26
Family Tetramerization domain of potassium channels 0.00000502
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011744   Gene: ENSGGOG00000012042   Transcript: ENSGGOT00000012084
Sequence length 602
Comment pep:known_by_projection chromosome:gorGor3.1:12:5179359:5181167:1 gene:ENSGGOG00000012042 transcript:ENSGGOT00000012084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIALVPLENGGAMTVRGGDEARASCGQATGGELQCPPTAGLSDGPKEPAPKGRGAQRDA
DSGVRPLPPLPEELPRPRRPPPEDEEEEGDPGLGTVEDQALGTASLHHQRVHINISGLRF
ETQLGTLAQFPNTLLGDPAKRLRYFDPLRNEYFFDRNRPSFDGILYYYQSGGRLRRPVNV
SLDVFADEIRFYQLGDEAMERFREDEGFIKEEEKPLPRNEFQRQVWLIFEYPESSGSARA
IAIVSVLVILISIITFCLETLPEFRDERELLRHPPAPHQPPAPAPGANGSGVMAPPSGPT
VAPLLPRTLADPFFIVETTCVIWFTFELLVRFFACPSKAGFSRNIMNIIDVVAIFPYFIT
LGTELAEQQPGGGGGGQNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGKTLQASM
RELGLLIFFLFIGVILFSSAVYFAEADNQGTHFSSIPDAFWWAVVTMTTVGYGDMRPITV
GGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDHEEPAVLKEEQGTQSLGPGLDRG
VQRKVSGSRGSFCKAGGTLENADSARRGSCPLEKCNVKAKSNVDLRRSLYALCLDTSRET
DL
Download sequence
Identical sequences G3R8M9
XP_004052586.1.27298 ENSGGOP00000011744 ENSGGOP00000011744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]