SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011767 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011767
Domain Number 1 Region: 11-137
Classification Level Classification E-value
Superfamily SMAD/FHA domain 7.27e-28
Family FHA domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011767   Gene: ENSGGOG00000012062   Transcript: ENSGGOT00000012108
Sequence length 351
Comment pep:known_by_projection chromosome:gorGor3.1:1:28820617:28843037:1 gene:ENSGGOG00000012062 transcript:ENSGGOT00000012108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAANSGSSLPLFDCPTWAGKPPPGLHLDVVKGDKLIEKLIIDEKKYYLFGRNPDLCDF
TIDHQSCSRVHAALVYHKHLKRVFLIDLNSTHGTFLGHIRLEPHKPQQIPIDSTVSFGAS
TRAYTLREKPQTLPSAVKGDEKMGGEDDELKGLLGLPEEETELDNLTEFNTAHNKRISTL
TIEEGNLDIQRPKRKRKNSRVTFSEDDEIINPEDVDPSVGRFRNMVQTAVVPVKKKRVEG
PGSLGLEESGSRRMQNFAFSGGLYGGLPPTHSEAGSQPHGIHGTALIGGLPMPYPNLAPD
VDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLLI
Download sequence
Identical sequences A0A096MSD8 A0A0D9S820 A0A2K5BY65 A0A2K5ICA7 A0A2K5QGY1 A0A2K6A3T9 A0A2K6BNN7 A0A2K6R526 A4FUE1 E2RQI3 F7GMG2 G1LX91 G1REZ0 G3R8Q2 G7NWV0 H2PYG2 L8IMF5 M3WYF3 M3YVV7 Q12972 U3BPG0 U6CUW9 W5NZ98
ENSMMUP00000009103 ENSGGOP00000011767 ENSBTAP00000005043 ENSFCAP00000019393 ENSCAFP00000017679 ENSPANP00000002701 ENSVPAP00000005943 ENSPVAP00000001362 HR6402 ENSPTRP00000000731 ENSPTRP00000000731 ENSBTAP00000005043 ENSPVAP00000001362 ENSP00000236412 ENSVPAP00000005943 ENSP00000311677 ENSMPUP00000015467 ENSP00000311677 ENSMPUP00000015467 ENSCAFP00000017679 ENSMMUP00000040476 gi|13699256|ref|NP_054829.2| ENSNLEP00000011790 ENSAMEP00000011694 NP_001253391.1.72884 NP_054829.2.87134 NP_054829.2.92137 XP_002913370.1.58354 XP_003271732.1.23891 XP_003989806.1.62641 XP_004005123.1.66739 XP_004025319.1.27298 XP_004394724.1.74151 XP_004741101.1.14098 XP_005544310.1.63531 XP_005895970.1.15283 XP_006049727.1.26621 XP_006173762.1.101512 XP_006196918.1.17985 XP_006924418.1.64745 XP_007097991.1.5354 XP_007977997.1.81039 XP_008692759.1.72690 XP_010378666.1.97406 XP_010828449.1.44457 XP_010946281.1.22495 XP_010992071.1.51371 XP_011356015.1.92234 XP_011761363.1.29376 XP_011810931.1.43180 XP_011837090.1.47321 XP_011970513.1.54773 XP_012295382.1.9421 XP_015987504.1.101085 XP_017390213.1.71028 XP_017829947.1.60252 XP_017912337.1.57651 XP_019288042.1.44245 XP_019505714.1.44202 XP_019835773.1.53367 XP_021539284.1.83697 XP_524632.2.37143 XP_544466.2.84170 ENSGGOP00000011767 9544.ENSMMUP00000040476 9598.ENSPTRP00000000731 9606.ENSP00000311677 9913.ENSBTAP00000005043 ENSOARP00000003496 ENSNLEP00000011790 ENSAMEP00000011694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]