SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011774 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011774
Domain Number 1 Region: 1-88
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000182
Family S100 proteins 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011774   Gene: ENSGGOG00000012074   Transcript: ENSGGOT00000012115
Sequence length 904
Comment pep:known_by_projection chromosome:gorGor3.1:1:131041985:131046904:-1 gene:ENSGGOG00000012074 transcript:ENSGGOT00000012115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQLLRNVLCVIETFHKYASEDSNGATLTGRELKQLIQGEFGDFFQPCVLHAVEKNSNLL
NIDSNGIISFDEFVLTIFNLLNLCYLDIKSLLSSELRQVTKPEKEKLDDVDLQATTGDGQ
WTVGTSPTQEERMLPSGMTSSSQLIPEESGAVGNNRVDPWREAKTHNFPGEASEHNDPKN
KHLEGDEQSQEVAQDIQTTEDNEGQLKTNKPMAGSKKTSSPTERKGQDKEISQEGDEPAR
EQSVSKIRDQFGEQKGNLATQSSPPKEATQRPSEDQEVRTEKEKHSNIQEPPLQREDEPS
SQHADLPEQAAARTPSQTQKSTDPKDVCRMFDTQEPGKDADQTPAKTKNLGEPEDYGRTS
ETQEKECETKDLPVQYGSRNGSETSDMRDERKERRGPEAHGTAGQKERDRKTRPPVLETQ
THDGKYQELQGLSKSKDAEKGSETQYLSSEGGDQTHPELEGTAVSGEEAEHTKEGTAKAF
VNSKNAPAAERTLGAKERTQDLAPLEKQSVGENTRVTKTHDKPVEEEDGYQGEDPESPFI
QSDEGSSETPNSLASEEGNSSSETGELPVQGDSQSQGDQHGESVQGGHNNNPDTQRQGTP
GEKNRALEAMVPAVRGEDVQLTEDQEQPAGGEHKNQGPGTKGPGVAVEPNGHPEEQESTA
GDENRKSLEIEITGALDEDFTDQLSLMQLPGKGDGRNELKVPGPSSKEEKGRATEAQNTL
LKSLDEDNSASLKIQLETKEPVTSEEEGESPQKLAGEGGDHKSPAKKEHNCSVPWPSLEK
QMQRDKEPCSVERGAVHSSPLYQYLQEKILQQTNVTQEEHQKQVQIAQASGPELCSVSLT
SEISDCSVFFNYSQASQPYTRGLPLDESPAGAQETPAPQALEHKQGHPQRERLVPQREAS
TTKQ
Download sequence
Identical sequences G3R8Q9
XP_004026723.1.27298 ENSGGOP00000011774 ENSGGOP00000011774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]