SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011780 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011780
Domain Number 1 Region: 332-402
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.49e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0000519
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011780   Gene: ENSGGOG00000012065   Transcript: ENSGGOT00000012121
Sequence length 1146
Comment pep:known_by_projection chromosome:gorGor3.1:22:26196851:26276676:1 gene:ENSGGOG00000012065 transcript:ENSGGOT00000012121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDESGELGGLETMETLTELGDELTLGDIDEMLQFVSNQVGEFPDLFSEQLCSSFPGSGGS
GSSSGSSGSSGSSSSSSSSNGRGSSSGAVDPSMPRSFTQVTLPSFSPSAASPQAPTLQVK
VSPTSVPTTPRATPILQPRPQPQPQPQAQLQQQTVMITPTFSTAPQTRIIQQPLIYQNAA
TSFQVLQPQVQSLVTSSQVQPVTIQQQVQTVQAQRVLTQTANGTLQTLAPATVQTVAAPQ
VQQVPVLVQPQIIKTDSLVLTTLKTDGSPVMAAVQNPALTALTTPIQTAALQVPTLVGSS
GTILTTMPVMMGQEKVPIKQVPGGVKQLEPPKEGERRTTHNIIEKRYRSSINDKIIELKD
LVMGTDAKMHKSGVLRKAIDYIKYLQQVNHKLRQENMVLKLANQKNKLLKGIDLGSLVDN
EVDLKIEDFNQNVLLMSPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALG
MVDRSRILLCVLTFLCLSFNPLTSLLQWGGAHDSDQRPHSGSGRSVLSFESGSGGWFDWM
MPTLLLWLVNGVIVLSVFVKLLVHGEPVIRPHSRSSVTFWRHRKQADLDLARGDFAAAAA
NLQTCLAVLGRALPTSRLDLACSLSWNVIRYSLQKLRLVRWLLKKVFQCRRATPATEAGF
EDEAKTSARDAALAYHRLHQLHITGKLPAGSACSDVHMALCAVNLAECAEEKIPPSTLVE
IHLTAAMGLKTRCGGKLGFLASYFLSRAQSLCGPEHSAVPDSLRWLCHPLGQKFFMERSW
SVKSAAKESLYCAQRNPADPIAQVHQAFCKNLLERAIESLVKPQAKKKAGDQEEESCEFS
SALEYLKLLHSFVDSVGVMSPPLSSSCVLKSALGPDIICRWWTSAITVAISWLQGDDAAV
RSHFTKVERIPKALEVTESPLVKAIFHACRAMHASLPGKADGQQSSFCHCERASGHLWSS
LNVSGATSDPALNHVVQLLTCDLLLSLRTALWQKQASASQAVGETYHASGAELAGFQRDL
GSLRRLAHSFRPAYRKVFLHEATVRLMAGASPTRTHQLLEHSLRRRTTQSTKHGEVDAWP
GQRERATAILLACRHLPLSFLSSPGQRAVLLAEAARTLEKVGDRRSCNDCQQMIVKLGGG
TAIAAS
Download sequence
Identical sequences G3R8R4
XP_018874010.1.27298 ENSGGOP00000011780 ENSGGOP00000011780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]