SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011844 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011844
Domain Number 1 Region: 247-340
Classification Level Classification E-value
Superfamily HMG-box 1.7e-25
Family HMG-box 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011844   Gene: ENSGGOG00000012139   Transcript: ENSGGOT00000012185
Sequence length 526
Comment pep:known_by_projection chromosome:gorGor3.1:8:56761842:57088727:-1 gene:ENSGGOG00000012139 transcript:ENSGGOT00000012185 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVRFYPPPAQPAAAPDAPCLGPSPCLDPYYCNKFDGENMYMSMTEPSQDYVPASQSYPG
PSLESEDFNIPPITPPSLPDHSLVHLNEVESGYHSLCHPMNHNGLLPFHPQNMDLPEITV
SNMLGQDGTLLSNSISVMPDIRNPEGTQYSSHPQMAAMRPRGQPADIRQQPGMMPHGQLT
TINQSQLSAQLGLNMGGSNVPHNSPSPPGSKSATPSPSSSVHEDEGDDTSKINGGEKRPA
SDMGKKPKTPKKKKKKDPNEPQKPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWD
GLGEEQKQVYKKKTEAAKKEYLKQLAAYRASLVSKSYSEPVDVKTSQPPQLINSKPSVFH
GPSQAHSALYLSSHYHQQPGMNPHLTAMHPSLPRNIAPKPNNQMPVTVSIANMAVSPPPP
LQISPPLHQHLNMQQHQPLTMQQPLGNQLPMQVQSALHSPTMQQGFTLQPDYQTIINPTS
TAAQVVTQAMEYVRSGCRNPPPQPVDWNNDYCSSGGMQRDKALYLT
Download sequence
Identical sequences H2QW77 O94900
ENSGGOP00000011844 ENSPTRP00000034719 NP_055544.1.87134 NP_055544.1.92137 XP_003809106.1.60992 XP_519777.2.37143 ENSGGOP00000011844 ENSPTRP00000034719 ENSP00000354842 ENSP00000354842 ENSP00000354842 gi|7662322|ref|NP_055544.1| 9598.ENSPTRP00000034719 9606.ENSP00000354842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]