SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011848 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011848
Domain Number 1 Region: 50-201
Classification Level Classification E-value
Superfamily EF-hand 2.24e-16
Family Calmodulin-like 0.039
Further Details:      
 
Domain Number 2 Region: 176-255
Classification Level Classification E-value
Superfamily EF-hand 0.00000466
Family Calmodulin-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011848   Gene: ENSGGOG00000012144   Transcript: ENSGGOT00000012189
Sequence length 296
Comment pep:novel chromosome:gorGor3.1:6:87153719:87154622:-1 gene:ENSGGOG00000012144 transcript:ENSGGOT00000012189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AKPTVRKERVVRPDSELGERLPEVNQSFQYRHEAFLGKEDSKTFDQLTLDKSKERLGKIV
DRINNDGDGFGTTEELKTWIKRVQKRYIFDDVAKVWRDYDRDEDDEEYKQATYDLGNPAE
FHDSSDHYTFKKMLPRDERRFKAADLDGALTATREEFTAFLHTEEFEHMKEIVVLETLED
NDKNGDGFVDQDEYIVVMFSHEENGSEPDWVLSEREQFNEFRDLNKDRKLDKDEIRHWIL
SQDYDHAQGEARHLVYMSQTKTRMRAKEEILENWNMFVGSQATNYGEDLTKNHDEL
Download sequence
Identical sequences ENSGGOP00000011848 ENSGGOP00000011848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]