SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011853 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011853
Domain Number 1 Region: 22-269
Classification Level Classification E-value
Superfamily Aquaporin-like 1.01e-72
Family Aquaporin-like 0.00000368
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011853   Gene: ENSGGOG00000012151   Transcript: ENSGGOT00000012194
Sequence length 295
Comment pep:known_by_projection chromosome:gorGor3.1:15:37272136:37316414:1 gene:ENSGGOG00000012151 transcript:ENSGGOT00000012194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPEGAEKRKSFKQRLVLKSSLAKETLSEFLGTFILIVLGCGCVAQAILSRGRFGGIITI
NVGFSMAVAMAIYVAGGVSGGHVNPALSLAMCLFGRMKWFKLPFYVGAQFLGAFVGAATV
FGIYYDGLMSFAGGKLLIVGENATAHIFATYPAPYLSLANAFADQVVATMILLIIVFAIF
DSRNLGAPRGLEPIAIGLLIIVIASSLGLNSGCAMNPARDLSPRLFTALAGWGFEVFRAG
NNFWWIPVVGPLVGAVIGGLIYVLVIEIHHPEPDSVFKAEQSEDKPEKYELSVIM
Download sequence
Identical sequences G3R8Y0
ENSGGOP00000011853 ENSGGOP00000011853 XP_004056310.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]