SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011873 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011873
Domain Number 1 Region: 377-618
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.49e-53
Family FolH catalytic domain-like 0.00000271
Further Details:      
 
Domain Number 2 Region: 622-778
Classification Level Classification E-value
Superfamily Transferrin receptor-like dimerisation domain 2.62e-46
Family Transferrin receptor-like dimerisation domain 0.00000483
Further Details:      
 
Domain Number 3 Region: 251-395
Classification Level Classification E-value
Superfamily PA domain 5.23e-35
Family PA domain 0.0000905
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011873   Gene: ENSGGOG00000012162   Transcript: ENSGGOT00000012214
Sequence length 782
Comment pep:known_by_projection chromosome:gorGor3.1:7:98117663:98138095:-1 gene:ENSGGOG00000012162 transcript:ENSGGOT00000012214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERLWGLFQRAQQLSPRSSQTVYQRVEGPRKGHPLAHFCPMELRGPEPLGSRPRQPNLIP
WAAAGRRAAPYLVLTALLIFTGAFLLGYVAFRGSCQACGDSVLVVSEDVNYEPDLDFHQG
TLYWSDLQAMFLQFLGEGRLEDTISIRLDRPRKALNASPRCLDLEQGVLRRKTSKQMHLC
VQIQKLGPPMALFWDDAGCDQGSGVPGLEDPDLDCMDVAQAIKGLTGYFKCLHEAHVEDG
GDEEGLLPAQLALSKESSSHLPPQVTNAQDFGAQGVLIYPEPADFSQDPPKPSLSSQQAV
YGHVHLGTGDPYTPGFPSFNQTQFPPVASSGLPSIPAQPISADIASRLLRKLKGPVAPQE
WQGSLLGSPYHLGPGPRLRLVVNNHRTSTPINNIFGCIEGRSEPDHYVVIGAQRDAWGPG
AAKSAVGTAILLELVRTFSSMVSNGFRPRRSLLFISWDGGDFGSVGSTEWLEGYLSVLHL
KAVVYVSLDNAVLGDDKFHAKTSPLLTSLIESVLKQVDSPNHSGQTLYEQVVVTNPSWDA
EVIRPLPMDSSAYSFTAFVGVPAVEFSFMEDDQAYPFLHTKEDTYENLHKVLQGRLPAVA
QAVAQLAGQLLIRLSHDRLLPLDFGRYGDVVLRHIGNLNEFSGDLKARGLTLQWVYSARG
DYIRAAEKLRQEIYSSEERDERLTRMYNVRIMRVEFYFLSQYVSPADSPFRHIFMGRGDH
TLGALLDHLRLLRSNSSGTPRATSSTGFQESRFRRQLALLTWTLQGAANALSGDVWNIDN
NF
Download sequence
Identical sequences ENSGGOP00000011873 ENSGGOP00000011873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]