SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011883 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011883
Domain Number 1 Region: 1082-1302
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-53
Family DBL homology domain (DH-domain) 0.0000000949
Further Details:      
 
Domain Number 2 Region: 1299-1317,1347-1470
Classification Level Classification E-value
Superfamily PH domain-like 4.51e-48
Family Pleckstrin-homology domain (PH domain) 0.000021
Further Details:      
 
Domain Number 3 Region: 507-622
Classification Level Classification E-value
Superfamily PH domain-like 6.56e-19
Family Pleckstrin-homology domain (PH domain) 0.0037
Further Details:      
 
Domain Number 4 Region: 863-978
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000426
Family PDZ domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011883   Gene: ENSGGOG00000012161   Transcript: ENSGGOT00000012224
Sequence length 1710
Comment pep:known_by_projection chromosome:gorGor3.1:6:156218885:156353688:1 gene:ENSGGOG00000012161 transcript:ENSGGOT00000012224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNSDSQYTLQGSKNHSNTITGAKQIPCSLKIRGIHTKEEKSLHGWGHGSSGAGYKSRSL
ARSCLSHFKSNQPYASRLGGPTCKVSRGVAYSTHRTNAPGKDFQGINAAFSTENGFHSVG
HEPADNHVTSRDCNGHLLNCYGRNESIASTPLGEDRKSPRVLIKTLGKLDGCLRVEFHNG
GNPSKVPAEDCSEPVQLLRYSPTLASETSPVPEARRESSADSLPSHRPSPTDSRLRSSKG
SSLSSESSWYDSPWGNAGELSEAEGSFLAPGMPDPSLHASFPPGDAKKPFNQSSSLSSLR
ELYKDANLGSLSPSGIRLSDEYMGTHASLSNRVSFASDIDVPSRVAHRDPVQYSSFTLPC
RKPKALVEDTAKKDSLKARMRRISDWTGSLSRKKRKLQEPRSKEGSDYFDSRSDGLNTDV
QGSSQASAFLWSGGSAQILSQRSESTHAIGSDPLRQNIYENFMRELEMSRTNTENIETST
ETAESSSESLSSLEQLDLLFEKEQGVVRKAGWLFFKPLVTVQKERKLELVARRKWKQYWV
TLKGCTLLFYETYGKNSMDQSSAPRCALFAEDSIVQSVPEHPKKENVFCLSNSFGDVYLF
QATSQTDLENWVTAVHSACASLFAKKHGKEDTLRLLKNQTKNLLQKIDMDSKMKKMAELQ
LSVVSDPKNRKAIENQIQQWEQNLEKFHMDLFRMRCYLASLQGGELPNPKSLLAAASRPS
KLALGRLGILSVSSFHALVCSRDDSALRKRTLSLTQRGRNKKGIFSSLKGLDTLARKGKE
KRPSITQVDELLHIYGSTVDSVPRDNAWEIQTYVYFQDNHGVTVGIKPEHRVEDILTLAC
KMRQLEPSHYGLQLRKLVDDNVEYCIPAPYEYMQEQVYDEIEVFPLNVYDVQLTKTGSVC
DFGFAVTAQVDERQHLSRIFISDVLPDGLAYGEGLRKGNEIMTLNGEAVSDLDLKQMEAL
FSEKSVGLTLIARPPDTKATLCTSWSDSDLFSRDQKSLLPPPNQSQLLEEFLDNFKKNTA
NDFSNVPDITTGLKRSQTDGTLDQVSHREKMEQTFRSAEQITALCRSFNDSQANGMEGPR
ESQDPPPRPLARHLSDADRLRKVIQELVDTEKSYVKDLSCLFELYLEPLQNETFLTQDEM
ESLFGSLPEMLEFQKVFLETLEDGISASSDFNTLETPSQFRKLLFSLGGSFLYYADHFKL
YSGFCANHIKVQKVLERAKTDKAFKAFLDARNPTKQHSSTLESYLIKPVQRVLKYPLLLK
ELVSLTDQESEEHYHLTEALKAMEKVASHINEMQKIYEDYGTVFDQLVAEQSGTEKEQPE
WSSEVMDVLDPRGKLTKGTLEEPRTLVTELSMGELLMHSTVSWLNPFLSLGKARKDLELT
VFPSNSRPAHNSTDLDPFKFRWLIPISALQVRLGNPAGTENNSIWELIHTKSEIEGRPET
IFQLCCSDSESKTNIVKVIRSILRENFRRHIKCELPLEKTCKDRLVPLKNRVPVSAKLAS
SRSLKVLKNSSSNEWTGETGKGTLLDSDEGSLSSGTQSSGCPTAEGRQDSKSTSPGKYPH
PGLADFADNLIKESDILSDEDDDHHRTVKQGSPTKDIEIQFQRLRISEDPDVHPEAEQQP
GPESGEGQKGGEQPKLVRGHFCPIKRKANSTKRDRGTLLKAQIRHQSLDSQSENATIDLN
SVLEREFSVQSLTSVVSEECFYETESHGKS
Download sequence
Identical sequences ENSGGOP00000011883 ENSGGOP00000020075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]