SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011908 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011908
Domain Number 1 Region: 32-329
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.31e-62
Family Bacterial PLC 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011908   Gene: ENSGGOG00000012207   Transcript: ENSGGOT00000012249
Sequence length 341
Comment pep:known_by_projection chromosome:gorGor3.1:3:110939612:110986457:1 gene:ENSGGOG00000012207 transcript:ENSGGOT00000012249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAVKKARRKLRMGTVCSPNPSGTKTSSEVCNADWMASLTPHLHNLPLSNLAIPGSHDSF
SYWVDEKSPVGPDQTQAIKRLARISLVKKLMKKWSVTQNLTFREQLEAGIRYFDLRVSSK
PGDADQEIYFIHGLFGIKVWDGLMEIDSFLTQHPQEIIFLDFNHFYAMDETHHKCLVLRI
QEAFGNKLCPACSVESLTLRTLWEKNCQVLIFYHCPFYKQYPFLWPGKKIPAPWANTTSV
CKLILFLETTLSERAPRGSFHVSQAILTPRVKTIARGLVGGLKNTLVHRNLPAILDWVKT
QKPGAMGVNIITSDFVDLVDFAATVIKLNDLLQEDTALAKC
Download sequence
Identical sequences A0A2I2ZT53
XP_018879815.1.27298 ENSGGOP00000011908 ENSGGOP00000011908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]