SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011918 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011918
Domain Number 1 Region: 278-552
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 8.35e-80
Family Leukotriene A4 hydrolase catalytic domain 0.00051
Further Details:      
 
Domain Number 2 Region: 60-270
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 3.66e-53
Family Leukotriene A4 hydrolase N-terminal domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011918   Gene: ENSGGOG00000012203   Transcript: ENSGGOT00000012259
Sequence length 914
Comment pep:known_by_projection chromosome:gorGor3.1:5:79918715:79958233:1 gene:ENSGGOG00000012203 transcript:ENSGGOT00000012259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFHSSAMVNSHRKPMFNIHRGFYCLAAILPQICICSQFSVPSSYHFTEDPGAFPVATNGE
RFPWQELRLPSVVIPLHYDLFVHPNLTSLDFVASEKIEVLVSNATQFIILHSKDLEITNA
TLQSEEDSRYMEPGKELKVLSYPAHEQIALLVPEKLTPHLKYYVAIDFQAKLGDGFEGFY
KSTYRTLGGETRILAVTDFEPTQARMAFPCFDEPLFKANFSIKIRRESRHIALSNMPKVK
TIELEGGLLEDHFETTVKMSTYLVAYIVCDFHSVSGFTSSGVKVSIYASPDKRNQTHYAL
QASLKLLEFYEKYFDIYYPLSKLDLIAIPDFAPGAMENWGLITYRETSLLFDPKTSSASD
KLWVTRVIAHELAHQWFGNLVTMEWWNDIWLNEGFAKYMELIAVNATYPELQFDDYFLNV
CFEVITKDSLNSSRPISKPAETPTQIQEMFDEVSYNKGACILNMLKDFLGEEKFQKGIIQ
YLKKFSYRNAKNDDLWSSLSNSCLESDFTSGGVCHSDPKMTSNMLAFLGENAEVKEMMTT
WTLQKGIPLLVVKQDGCSLRLQQERFLQGVFQEDPEWRALQERYLWHIPLTYSTSSSNVI
HRHILKSKTDTLDLPEKTSWVKFNVDSNGYYIVHYEGHGWDQLITQLNQNHTLLRPKDRV
GLIHDVFQLVGAGRLTLDKALDMTYYLQHETSSPALLEGLSYLELFYHMMDRRNISDISE
NLKRYLLQYFKPVIDRQSWSDEGSVWDRMLRSALLKLACDLNHAPCIQKAAELFSQWMES
SGKLNIPTDVLKIVYSVGAQTTAGWNYLLEQYELSMSSAEQNKILYALSTSKHQEKLLKL
IELGMEGKVIKTQNLAALLHAIARRPKGQQLAWDFVRENWTHLLKKFDLGSYDIRMIISG
TTAHFSSKDKLQEV
Download sequence
Identical sequences ENSGGOP00000011918 ENSGGOP00000011918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]