SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011933 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011933
Domain Number 1 Region: 145-284
Classification Level Classification E-value
Superfamily EF-hand 0.00000287
Family Calbindin D9K 0.096
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000011933
Domain Number - Region: 88-165
Classification Level Classification E-value
Superfamily EF-hand 0.0292
Family Calmodulin-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011933   Gene: ENSGGOG00000012223   Transcript: ENSGGOT00000012274
Sequence length 291
Comment pep:known_by_projection chromosome:gorGor3.1:14:16328561:16373428:-1 gene:ENSGGOG00000012223 transcript:ENSGGOT00000012274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDWKEVLRRRLATPNTCPNKKKSEQELKDEEMDLFTKYYSEWKGGRKNTNEFYKTIPRFY
YRLPAEDEVLLQKLREESRAVFLQRKSRELLDNEELQNLWFLLDKHQTPPMIGEEAMINY
ENFLKVGEKAGAKCWLHQTRIGLSLYDVAGQGYLRESDLENYILELIPTLPQLDGLEKSF
YSFYVCTAVRKFFFFLDPLRTGKIKIQDILACSFLDDLLELRDEELSKESQETNWFSAPS
ALRVYGQYLNLDKDHNGMLSKEELSRYGTATMTNVFLDRVFQECLTYDGEM
Download sequence
Identical sequences ENSGGOP00000011933 ENSGGOP00000011933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]