SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011965 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011965
Domain Number 1 Region: 9-79
Classification Level Classification E-value
Superfamily SNARE fusion complex 5.56e-22
Family SNARE fusion complex 0.0000182
Further Details:      
 
Domain Number 2 Region: 130-203
Classification Level Classification E-value
Superfamily SNARE fusion complex 3.93e-21
Family SNARE fusion complex 0.0000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011965   Gene: ENSGGOG00000012265   Transcript: ENSGGOT00000012308
Sequence length 206
Comment pep:known_by_projection chromosome:gorGor3.1:20:10459776:10548288:1 gene:ENSGGOG00000012265 transcript:ENSGGOT00000012308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERI
EEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARV
VDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDR
IMEKADSNKTRIDEANQRATKMLGSG
Download sequence
Identical sequences A0A091M093 A0A093EKR1 A0A0D9RMF5 A0A0P6JEA4 A0A1S2ZUL3 A0A1S3EPG0 A0A1U7QLP3 A0A1U7TCJ4 A0A1V4IFX9 A0A218V6T5 A0A2I0M9G2 A0A2I0TVE0 A0A2I3MH75 A0A2J8MSS8 A0A2K5JMC8 A0A2K5M6Y4 A0A2K5Q4M8 A0A2K5ZYV0 A0A2K6DB38 A0A2K6EFV2 A0A2K6LKC2 A0A2K6R765 A0A2K6V7E8 E2RPM2 F6VJI9 F6VM87 F6VUT7 F7HEW0 G1LAD3 G1P8S1 G1RWF4 G1TAX9 G3R985 G3TC05 G3VSV6 G7N2Y7 G7PGZ0 H0Z6W7 H2P114 I3LAV3 I3MME1 L8J2B0 M3WCL5 M3Y528 P60877 P60878 P60879 P60880 P60881 Q17QQ3 Q5R1X1 U3IMQ0 U3K932 W5PKN8
ENSPTRP00000022723 ENSTSYP00000010269 ENSNLEP00000017581 ENSBTAP00000010961 ENSSHAP00000006261 ENSCJAP00000039744 ENSMMUP00000014487 ENSMPUP00000006429 ENSEEUP00000012198 ENSAMEP00000003856 ENSOCUP00000013851 ENSAMEP00000003856 ENSOANP00000013384 ENSECAP00000020614 ENSTGUP00000006316 ENSMODP00000005909 ENSSTOP00000012692 ENSMMUP00000014487 ENSLAFP00000011551 ENSGGOP00000011965 ENSETEP00000010292 ENSMUSP00000028727 ENSMPUP00000006429 GO.49177 ENSLAFP00000011551 ENSMODP00000005909 ENSBTAP00000010961 ENSCAFP00000034475 ENSETEP00000010292 ENSPVAP00000014689 NP_001009094.1.37143 NP_001028036.1.72884 NP_001069714.1.59421 NP_001069714.1.76553 NP_001309832.1.87134 NP_001309832.1.92137 NP_001309833.1.87134 NP_001309833.1.92137 NP_001309834.1.87134 NP_001309834.1.92137 NP_001309835.1.87134 NP_001309835.1.92137 NP_001309836.1.87134 NP_001309836.1.92137 NP_001309837.1.87134 NP_001309837.1.92137 NP_001309838.1.87134 NP_001309838.1.92137 NP_001309839.1.87134 NP_001309839.1.92137 NP_035558.1.92730 NP_112253.1.100692 NP_112253.1.4139 NP_570824.1.87134 NP_570824.1.92137 NP_990789.1.86415 XP_001374436.1.35504 XP_001493159.1.31192 XP_001513799.1.37387 XP_002199106.1.42559 XP_002711019.1.1745 XP_002747405.1.60252 XP_003252692.1.23891 XP_003411547.1.64505 XP_003758237.1.9362 XP_003810611.1.60992 XP_003933252.1.74449 XP_003983829.1.62641 XP_004014203.1.66739 XP_004061856.1.27298 XP_004061858.1.27298 XP_004276515.1.21590 XP_004406021.1.74151 XP_004433811.1.5094 XP_004461889.1.11602 XP_004461890.1.11602 XP_004593413.1.84141 XP_004610980.1.94378 XP_004634357.1.9945 XP_004661578.1.11716 XP_004687227.1.23501 XP_004697888.1.18182 XP_004751613.1.14098 XP_004751614.1.14098 XP_004840874.1.39548 XP_005019841.1.99704 XP_005042819.1.66865 XP_005068743.1.91757 XP_005147524.1.78019 XP_005238654.1.75256 XP_005260865.1.92137 XP_005320538.1.77405 XP_005365598.1.66349 XP_005380927.1.28644 XP_005380928.1.28644 XP_005422641.1.5688 XP_005445658.1.10750 XP_005486882.1.73095 XP_005510761.1.63277 XP_005525494.1.90289 XP_005568410.1.63531 XP_005568411.1.63531 XP_005634851.1.84170 XP_005687869.1.57651 XP_005874714.1.60319 XP_005874716.1.60319 XP_005886961.1.15283 XP_005980488.1.78601 XP_006071965.1.26621 XP_006088015.1.53796 XP_006150975.1.99106 XP_006187124.1.101512 XP_006758149.1.95426 XP_006758150.1.95426 XP_006870454.1.41390 XP_006894309.1.29581 XP_006921653.1.64745 XP_006984021.1.50099 XP_007086875.1.5354 XP_007101565.1.24612 XP_007165316.1.59432 XP_007450269.1.90284 XP_007524780.1.11023 XP_007954616.1.48129 XP_008016371.1.81039 XP_008057769.1.4292 XP_008139311.1.99482 XP_008498783.1.100939 XP_008519618.1.77740 XP_008582581.1.73410 XP_008640231.1.15636 XP_008701571.1.72690 XP_008825411.1.79516 XP_008825412.1.79516 XP_008825413.1.79516 XP_008931228.1.51550 XP_008931228.1.96775 XP_008947596.1.37566 XP_008961152.1.60992 XP_008961153.1.60992 XP_008993995.1.60252 XP_009091950.1.15306 XP_009280798.1.47732 XP_009317845.1.49731 XP_009434909.1.37143 XP_009474438.1.38621 XP_009510101.1.22320 XP_009554785.1.62272 XP_009580661.1.87690 XP_009644657.1.23211 XP_009672274.1.43253 XP_009698891.1.71050 XP_009810127.1.37116 XP_009874107.1.31609 XP_009884339.1.48241 XP_009905191.1.92783 XP_009925407.1.2804 XP_009934261.1.35112 XP_009956350.1.99599 XP_009973895.1.75343 XP_009983986.1.11325 XP_009998475.1.85724 XP_010081575.1.40768 XP_010117649.1.88979 XP_010153046.1.22856 XP_010191376.1.17318 XP_010224268.1.20684 XP_010285635.1.48707 XP_010401339.1.2935 XP_010573111.1.12557 XP_010614304.1.5607 XP_010614305.1.5607 XP_010948292.1.22495 XP_010992649.1.51371 XP_011368497.1.92234 XP_011599141.1.59079 XP_011739460.1.29376 XP_011739461.1.29376 XP_011804250.1.43180 XP_011854079.1.47321 XP_011854097.1.47321 XP_011907468.1.92194 XP_011907470.1.92194 XP_011907471.1.92194 XP_011907472.1.92194 XP_012022845.1.54773 XP_012310855.1.9421 XP_012381938.1.11602 XP_012512651.1.63892 XP_012636270.1.48125 XP_012636271.1.48125 XP_012866256.1.60039 XP_013037570.1.65836 XP_013805346.1.3284 XP_014310595.1.53796 XP_014310596.1.53796 XP_014401956.1.60319 XP_014688295.1.49734 XP_014750538.1.99236 XP_014821885.1.91963 XP_014937013.1.86478 XP_015004823.1.72884 XP_015097342.1.17985 XP_015138942.1.86415 XP_015338382.1.40921 XP_015415762.1.95426 XP_015476040.1.82291 XP_015712629.1.68032 XP_015993584.1.101085 XP_017172247.1.92730 XP_017379433.1.71028 XP_017379434.1.71028 XP_017379435.1.71028 XP_017690038.1.3805 XP_017724371.1.44346 XP_017724372.1.44346 XP_017827446.1.60252 XP_018773592.1.15306 XP_018872476.1.27298 XP_019318065.1.44245 XP_019318066.1.44245 XP_019318067.1.44245 XP_019590451.1.88060 XP_019590452.1.88060 XP_019654718.1.58354 XP_019682388.1.62641 XP_019682390.1.62641 XP_019682391.1.62641 XP_019797053.1.83887 XP_019828621.1.53367 XP_020007037.1.5219 XP_020748454.1.74333 XP_020748455.1.74333 XP_020841587.1.61212 XP_020934018.1.46622 XP_020934019.1.46622 XP_021048173.1.100879 XP_021245769.1.32913 XP_021395950.1.53032 XP_021512597.1.76796 ENSMUSP00000028727 ENSVPAP00000006762 ENSP00000254976 ENSDNOP00000026398 ENSOANP00000013384 ENSOCUP00000013851 ENSVPAP00000006762 ENSP00000254976 ENSPVAP00000014689 ENSPTRP00000022723 ENSMUSP00000028727 ENSOARP00000011011 ENSSTOP00000012692 ENSSHAP00000006261 ENSGGOP00000011965 ENSCJAP00000039744 ENSTTRP00000005922 ENSP00000254976 ENSPPYP00000011970 ENSTTRP00000005922 ENSSSCP00000021171 ENSGALP00000014636 ENSTGUP00000006316 ENSMEUP00000014770 ENSNLEP00000017581 ENSTSYP00000010269 ENSEEUP00000012198 ENSAPLP00000008523 ENSMLUP00000006584 ENSMLUP00000006584 10090.ENSMUSP00000028727 59729.ENSTGUP00000006316 9544.ENSMMUP00000014487 9600.ENSPPYP00000011970 9606.ENSP00000254976 9796.ENSECAP00000020614 9913.ENSBTAP00000010961 9986.ENSOCUP00000013851 ENSECAP00000020614 ENSSSCP00000021171 ENSPPYP00000011970 gi|18765735|ref|NP_570824.1| ENSMEUP00000014770 ENSCAFP00000008459 ENSFALP00000011536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]