SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011966 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011966
Domain Number 1 Region: 64-144
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000113
Family Calmodulin-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011966   Gene: ENSGGOG00000012267   Transcript: ENSGGOT00000012310
Sequence length 146
Comment pep:known_by_projection chromosome:gorGor3.1:2a:47685192:47699642:-1 gene:ENSGGOG00000012267 transcript:ENSGGOT00000012310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMRSLLRTPFLCGLLWAFCAPGARAEEPAASFSQPGSMGLDKNTVHDQEHIMEHLEGVI
NKPEAEMSPQELQLHYFKMHDYDGNNLLDGLELSTAITHVHKEEGSEQAPLMSEDELINI
IDGVLRDDDKNNDGYIDYAEFAKSLQ
Download sequence
Identical sequences A0A0D9RM47 A0A2J8XDB3 A0A2K5I1Y1 A0A2K5WNW9 A0A2K6BYM6 G3R986 H2QHV6 H9G1J3 Q5R8Z6 Q8NI22
NP_001127284.1.23681 NP_001164977.1.87134 NP_001164977.1.92137 NP_001164978.1.87134 NP_001164978.1.92137 NP_001164979.1.87134 NP_001164979.1.92137 NP_644808.1.87134 NP_644808.1.92137 XP_003309044.1.37143 XP_004029242.1.27298 XP_004029243.1.27298 XP_004029244.1.27298 XP_005576006.1.63531 XP_007968908.1.81039 XP_008974497.1.60992 XP_009235607.1.23681 XP_009235608.1.23681 XP_009235612.1.23681 XP_009235613.1.23681 XP_009440705.1.37143 XP_011791254.1.43180 XP_011791255.1.43180 XP_011791257.1.43180 XP_011791258.1.43180 XP_011791259.1.43180 XP_014199294.1.60992 XP_016803982.1.37143 XP_018876652.1.27298 ENSPTRP00000020424 ENSGGOP00000011966 ENSP00000317271 9598.ENSPTRP00000020424 9600.ENSPPYP00000013884 9606.ENSP00000317271 gi|21281683|ref|NP_644808.1| gi|284005451|ref|NP_001164977.1| gi|284005455|ref|NP_001164978.1| gi|284005457|ref|NP_001164979.1| ENSGGOP00000011966 ENSP00000317271 ENSP00000386261 ENSP00000386279 ENSP00000386386 ENSP00000386651 ENSP00000402717 ENSPTRP00000020424 ENSP00000317271 ENSP00000386261 ENSP00000386279 ENSP00000386386 ENSP00000386651 ENSP00000402717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]