SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011996 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011996
Domain Number 1 Region: 270-470
Classification Level Classification E-value
Superfamily Caspase-like 5.38e-68
Family Caspase catalytic domain 0.00000405
Further Details:      
 
Domain Number 2 Region: 19-124
Classification Level Classification E-value
Superfamily DEATH domain 3.18e-25
Family DEATH effector domain, DED 0.0039
Further Details:      
 
Domain Number 3 Region: 112-189
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000000483
Family DEATH effector domain, DED 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011996   Gene: ENSGGOG00000012288   Transcript: ENSGGOT00000012340
Sequence length 472
Comment pep:known_by_projection chromosome:gorGor3.1:2b:89619545:89646962:1 gene:ENSGGOG00000012288 transcript:ENSGGOT00000012340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSQGQHWCSSSDKNCKVSFREKLLIIDSNLGVQDVENLKFLCIGLVPNKKLEKSSSASD
VFEHLLAEDLLSEEDPFFLAELLYIIRQKKLLQHLNYTKEEVERLLPTRQSVSLFRNLLY
ELSEGIDSENLKDMIFLLKDSLPKTEMTSLSFLAFLEKQGKIDEDNLTCLEDLCKTVVPK
LLRNIEKYKREKAVQIMTPPVDKEAESYQGEEELVSQTDVKTFLEALPQESWQNKHAGSN
GNRATNGAPSLVSRGMQGASANTLNSETSTKRAAVYRMNRNHRGLCVIVNNHSFTSLKDR
QGTHKDAEILSHVFQWLGFTVHIHNNVTKVEMEEVLQKQKCNPAHADGDCFVFCILTHGR
FGAVYSSDEALIPIREIMSHFTALQCPRLAEKPKLFFIQACQGEEIQPSVSIEADALNPE
QAPTSLQDSIPAEADFLLGLATVPGYVSFRHVEEGSWYIQSLCNHLKKLVPR
Download sequence
Identical sequences ENSGGOP00000011996 ENSGGOP00000011996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]