SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012040 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012040
Domain Number 1 Region: 259-321
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000753
Family PHD domain 0.005
Further Details:      
 
Domain Number 2 Region: 53-112
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000199
Family PHD domain 0.0011
Further Details:      
 
Domain Number 3 Region: 812-871
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.0000000555
Family FHA domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012040   Gene: ENSGGOG00000012335   Transcript: ENSGGOT00000012385
Sequence length 1004
Comment pep:known_by_projection chromosome:gorGor3.1:5:55397184:55444164:1 gene:ENSGGOG00000012335 transcript:ENSGGOT00000012385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWEKMETKTIVYDLDTSGGLMEQIQALLAPPKTDEAEKRSRKPEKEPRRSGRATNHDSCD
SCKEGGDLLCCDHCPAAFHLQCCNPPLSEEMLPPGEWMCHRCTVRRKKREQKKELGHVNG
LVDKSGKRTTSPSSDTDLLDRSASKTELKAIAHARILERRASRPGTPTSSASTETPTSEQ
NDVDEDIIDVDEEPVAAEPDYVQPQLRRPFELLIAAAMERNPTQFQLPNELTCTTALPGS
SKRRRKEETTGKNVKKTQHELDHNGLVPLPVKVCFTCNRSCRVAPLIQCDYCPLLFHMDC
LEPPLTAMPLGRWMCPNHIEHVVLNQKNMTLSNRCQVFDRFQDTVSQHVIKVDFLNRIHK
KHPPNRRVLQSVKRRSLKVPDAIKSQYQFPPPLIAPAAIRDGELICNGIPEESQMHLLNS
EHLATQAEQQEWLCSVVALQCSILKHLSAKQMPSHWDSEQTEKADIKPVIVTDSSVTTSL
QTADKTPTPSHYPLSCPSGISTQNSLSCSPPHQSPALEDIGCSSCAEKSKKTPCGTANGP
VNTEVKANGPHLYSSPTDSTDPRRLPGANTPLPGLSHRQGWPRPLTPPAAGGLQNHTVGI
IVKTENATGPSSCPQRSLVPVPSLPPSIPSSCASIENTSTLQRKTVQSQIGPPLTDSRPL
GSPPNATRVLTPPQAAGDGILATAANQRFSSPAPSSDGKVSPGTLSIGSALTVPSFPANS
TAMVDLTNSLRAFMDVNGEIEINMLDEKLIKFLALQRIHQLFPSRVQPSPGSVGTHQLAS
GGHHIEVQRKEVQARAVFYPLLGLGGAVNMCYRTLYIGTGADMDVCLTNYGHCNYVSGKH
ACIFYDENTKHYELLNYSEHGTTVDNVLYSCDFSEKTPPTPPSSIVAKVQSVIRRRRHQK
QDEEPSEEAAMMSSQAQGPQRRPCNCKASSSSLIGGSGAGWEGTALLHHGSYIKLGCLQF
VFSITEFATKQPKGDASLLQDGVLAEKLSLKPHQGPVLRSNSVP
Download sequence
Identical sequences G3R9F8
ENSGGOP00000012040 ENSGGOP00000012040 XP_004042075.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]