SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012044 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012044
Domain Number 1 Region: 251-445
Classification Level Classification E-value
Superfamily SMAD/FHA domain 4.29e-63
Family Interferon regulatory factor 3 (IRF3), transactivation domain 0.0014
Further Details:      
 
Domain Number 2 Region: 24-129
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.09e-43
Family Interferon regulatory factor 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012044   Gene: ENSGGOG00000012342   Transcript: ENSGGOT00000012389
Sequence length 454
Comment pep:known_by_projection chromosome:gorGor3.1:6:270219:286841:1 gene:ENSGGOG00000012342 transcript:ENSGGOT00000012389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLEGGGRGGEFGMSAVSCGNGKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQ
DYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISD
PYKVYRIVPEGAKKGAKQLTLEDPQMSMSHPYTMTTPYPSLPAQQVHNYMMPPLDRSWRD
YVPDQPHPEIPYQCPVTFGPRGHHWQGPACENANAGCQVTGTFYACAPPESQAPGIPTEP
SIRSAEALALSDCRLHICLYYREILVKELTTSSPEGCRISHGHTYDASNLDQVLFPYPED
NGQRKNIEKLLSHLERGVVLWMAPDGLYAKRLCQSRIYWDGPLALCNDRPNKLERDQTCK
LFDTQQFLSELQAFAHHGRSLPRFQVTLCFGEEFPDPQRQRKLITAHVEPLLARQLYYFA
QQNSGHFLRGYDLPEHISNPEDYHRSIRHSSIQE
Download sequence
Identical sequences ENSGGOP00000012044 ENSGGOP00000012044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]