SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012046 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012046
Domain Number 1 Region: 25-569
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 1.77e-143
Family Myeloperoxidase-like 0.0000259
Further Details:      
 
Domain Number 2 Region: 805-941
Classification Level Classification E-value
Superfamily EF-hand 2.03e-29
Family Calmodulin-like 0.0072
Further Details:      
 
Domain Number 3 Region: 1276-1376
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 2.27e-16
Family Ferredoxin reductase FAD-binding domain-like 0.0082
Further Details:      
 
Domain Number 4 Region: 1386-1555
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 0.0000000000000432
Family Flavohemoglobin, C-terminal domain 0.065
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000012046
Domain Number - Region: 1090-1256
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0196
Family Calcium ATPase, transmembrane domain M 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012046   Gene: ENSGGOG00000012320   Transcript: ENSGGOT00000012391
Sequence length 1556
Comment pep:known_by_projection chromosome:gorGor3.1:15:23872461:23908246:1 gene:ENSGGOG00000012320 transcript:ENSGGOT00000012391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFCLALAWTLLVGAWTPLGAQNPISWEVQRFDGWYNNLMEHRWGSKGSRLQRLVPASYA
DGVYQPLGEPHLPNPRDLSNTISRGPAGLASLRNRTVLGVFFGYHVLSDLVSVETPGCPA
EFLNIRIPPGDPMFDPDQRGDVVLPFQRSRWDPETGRSPSNPRDPANQVTGWLDGSAIYG
SSHSWSDALRSFSRGQLASGPDPAFPRHSQNPLLMWAAPDPATGQNGPRGLYAFGAERGN
REPFLQALGLLWFRYHNLWAQRLARQHPDWEDEELFQHARKRVIATYQNIAVYEWLPSFL
QKTLPEYTGYRPFLDPSISSEFVTASEQFLSTMVPPGVYMRNASCHFQGVINRNSSVSRA
LRVCNSYWSREHPSLQSAEDVDALLLGMASQIAEREDHVLVEDVRDFWPGPLKFSRTDHL
ASCLQRGRDLGLPSYTKARAALGLSPITRWQDINPALSRSNDTVLEATAALYNQDLSWLE
LLPGGLLESHRDPGPLFSTIVLEQFVRLRDGDRYWFENTRNGLFSKKEIEEIRNTTLQDV
LVAVINIDPSALQPNVFVWHKGDPCPQPRQLSTEGLPACAPSVVRDYFEGSGFGFGVTIG
TLCCFPLVSLLSAWIVARLRMRNFKRLQGQDRQSIVSEKLVGGMEALEWQGHKEPCRPVL
VYLQPGQIRVVDGRLTMLRTIQLQPPQKVNLVLSSNRGRRTLLLKIPKEYDLVLLFNLEE
ERQALVENLRGALKESGLSIQEWELREQELMRAAVTREQRSHLLETFFRHLFSQQVQVLD
INQADAGTLPLDSSQKVREALTCELSRAEFAESLGLKPQDMFVESMFSLADKDGNGYLSF
REFLDILVVFMKGSPEEKSRLMFRMYDFDGNGLISKDEFIRMLRSFIEISNNCLSKAQLA
EVVESMFRESGFQDKEELTWEDFHFMLRDHNSELRFTQLCVKGVEVPEVIKDLCRRASYI
SQDMICPSPRVSARCSRSDIETELTPQRLQCPMDTDPPQEIRRRFGKKVTSFQPLLFTEA
HREKFQRSRLHQTVQQFKRFIENYRRHIGCVAVFYAIAGGLFLERAYYYAFAAHHTGITD
TTRVGIILSRGTAASISFMFSYILLTMCRNLITFLRETFLNRYVPFDAAVDFHRLIASTA
IVLTVLHSVGHVVNVYLFSISPLSVLSCLFPGLFHDDGSEFPQKYYWWFFQTVPGLTGVV
LLLILAIMYVFASHHFRRRSFRGFWLTHHLYILLYVLLIIHGSFALIQLPRFHIFFLVPA
IIYGGDKLVSLSRKKVEISVVKAELLPSGVTHLRFQRPQGFEYKSGQWVRIACLALGTTE
YHPFTLTSAPHEDTLSLHIRAAGPWTTRLREIYSAPTGDRCARYPKLYLDGPFGEGHQEW
HKFEVSVLVGGGIGVTPFASILKDLVFKSSVSCQVFCKKIYFIWVTRTQRQFEWLADIIR
EVEENDHQDLVSVHIYITQLAEKFDLRTTMLYICERHFQKVLNRSLFTGLRSITHFGRPP
FEPFFNSLQEVHPQQQVRKIGVFSCGPPGMTKNVEKACQLINRQDRTHFSHHYENF
Download sequence
Identical sequences ENSGGOP00000012046 ENSGGOP00000012046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]