SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012056 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012056
Domain Number 1 Region: 138-206
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000917
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 2 Region: 577-632
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000796
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 3 Region: 929-990
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000148
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 4 Region: 85-146
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000189
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 5 Region: 755-815
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000202
Family Complement control module/SCR domain 0.0000185
Further Details:      
 
Domain Number 6 Region: 517-574
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000223
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 7 Region: 812-873
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000236
Family Complement control module/SCR domain 0.0000235
Further Details:      
 
Domain Number 8 Region: 870-932
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000431
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 9 Region: 697-752
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000101
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 10 Region: 449-512
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000104
Family Complement control module/SCR domain 0.0037
Further Details:      
 
Domain Number 11 Region: 396-460
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000157
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 12 Region: 339-400
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000017
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 13 Region: 216-278
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000008
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 14 Region: 28-89
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000249
Family Complement control module/SCR domain 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000012056
Domain Number - Region: 273-333
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000157
Family Complement control module/SCR domain 0.006
Further Details:      
 
Domain Number - Region: 640-691
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0238
Family Complement control module/SCR domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012056   Gene: ENSGGOG00000012348   Transcript: ENSGGOT00000012401
Sequence length 991
Comment pep:known_by_projection chromosome:gorGor3.1:1:176404208:176497890:1 gene:ENSGGOG00000012348 transcript:ENSGGOT00000012401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLG
NIIMVCRKGEWVALNPLRKCQKKPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQL
LGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYRFGQAVRFVCNS
GYKIEGDEEMHCSDDGFWSKEKPKCVFGLLQLEKTCDNPYIPNGDYSPLRIKHRTGNEIT
YQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGSLYHENMRRPYFPVAVGK
YYSYYCDEHFETPSGSYWDYIHCTQNGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGKS
IDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVKSCDIPVFMNARAKNDFTWFKLNDTL
DYECHDGYESNTGSTTGSIVCGYNGWSDLPICYERECELPKIDVHLVPDRKKDQYKVGEV
LKFSCKPGFTIVGPNSVQCYHFGLSPDLPICKEQVQSCGPPPELLNGDVKEKTKEEYGHS
EVVEYYCNPRFLMKGPNKIQCVDGEWTTLPVCIVEESTCGDIPELEHGWAQLSSPPYYYG
DSVEFSCSESFTMIGHRSITCIHGVWTQLPQCVAIDKLKKCKSSNLIILEEHLKNKKEFD
HNSNIRYRCRGKEGWIHTVCINGRWDPEVNCSMAQIQLCPPPPQIPNSHNMTTTLNYRDG
EKVSVLCQENYLIQEGEEIICKDGRWQSIPLCVEKIPCSQPPQIEHGTINSSRSSQESYA
HGTKLSYTCEGSFRLSEENETTCYMGKWSSPPQCEGLPCKSPPEISHGVVAHMSDSYQYG
EEVTYKCFEGFGIDGPAIAKCLGEKWSHPPSCIKTDCLSLPSFENAIPMGEKKDLYKAGE
QVTYTCATYYKMDGASNVTCINSRWTGRPTCRDTSCVNPPTVQNAYIASRQMSKYPSGER
VRYECRSPYEMFGDEEVMCLNGNWTEPPQCK
Download sequence
Identical sequences ENSGGOP00000012056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]