SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012065 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012065
Domain Number 1 Region: 8-219,325-383
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.25e-49
Family FAD-linked reductases, N-terminal domain 0.0000812
Further Details:      
 
Domain Number 2 Region: 222-325
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.92e-26
Family D-aminoacid oxidase-like 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012065   Gene: ENSGGOG00000012368   Transcript: ENSGGOT00000012411
Sequence length 390
Comment pep:known_by_projection chromosome:gorGor3.1:5:55293373:55307708:-1 gene:ENSGGOG00000012368 transcript:ENSGGOT00000012411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAQKDLWDAIVIGAGIQGCFTAYHLAKHRKRILLLEQFFLPHSRGSSHGQSRIIRKAYL
EDFYTRMMHECYQIWAQLEHDAGTQLHRQTGLLLLGMKENQELKTIQANLSRQRVEHQCL
SSEELKQRFPNIRLPRGEVGLLDNSGGVIYAYKALRALQDAIRQLGGIVRDGEKVVEINP
GLLVTVKTTSRSYQAKSLVITAGPWTNQLLRPLGIELPLQTLRINVCYWREMVPGSYGVS
QAFPCFLWLGLCPHHIYGLPTGEYPGLMKVSYHHGNHADPEERDCPTARTDIGDVQILSS
FVRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPKYDNIVIGAGFSGHGFKLAPVVGKI
LYELSMKLTPSYDLAPFRISRFPSLGKAHL
Download sequence
Identical sequences G3R9I2
XP_004042078.1.27298 ENSGGOP00000012065 ENSGGOP00000012065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]