SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012101 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012101
Domain Number 1 Region: 528-576,604-655
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000756
Family Fibronectin type III 0.0071
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000012101
Domain Number - Region: 115-144
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0314
Family Merozoite surface protein 1 (MSP-1) 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012101   Gene: ENSGGOG00000013380   Transcript: ENSGGOT00000012448
Sequence length 804
Comment pep:known_by_projection chromosome:gorGor3.1:1:156203333:156512653:-1 gene:ENSGGOG00000013380 transcript:ENSGGOT00000012448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDPVHKHLCIRNEWGTNQGPWPYTIFQRGFDLVLGEQPSDKIFRFTYTLGEGMWLPLSK
SFVIPPAELAINPSAKCKTDMTVMEDAVEVREELMTSSSFDSLEVLLDSFGPVRDCSKDN
GGCSKNFRCISDRKLDSTGCVCPSGLSPMKDSSGCYDRHIGVDCSDGFNGGCEQLCLQQM
APFPDDPTLYNILMFCGCIEDYKLGVDGRSCQLITETCPEGSDCGESRELPMNQTLFGEM
FFGYNNHSKEVAAGQVLKGTFRQNNFARGLDQQLPDGLVVATVPLENQCLEEISEPTPDP
DFLTGMVNFSEVSGYPVLQHWKVRSVMYHIKLNQVAISQALSNALHSLDGATSRADFVAL
LDQFGNHYIQEAIYGFEESCSIWYPNKQVQRRLWLEYEDISKVISLIKKLKKSPSHTHLY
SLLASQILDSGTKRMAAGVRMECQSKGRCPSSCPLCHVTSSPDTPAEPVLLEVTKAAPIY
ELVTNNQTQRLLQEATMSSLWCSGTGDVIEDWCRCDSTAFGADGLPTCAPLPQPVLRLST
VHEPSSTLVVLEWEHSEPPIGVQIVDYLLRQEKVTDRMDHSKVETETVLSFVDDIISGAK
SPCAMPSQVPDKQLTTISLIIRCLEPDTIYMFTLWGVDNTGRRSRPSDVIVKTPCPVVDD
VKAQEIADKIYNLFNGYTSGKEQQTAYNTLLDLGSPTLHRVLYHYNQHYESFGEFTWRCE
DELGPRKAGLILSQLGDLSSWCNGLLQQPKISLRRSSLKYLGCRYSEIKPYGLDWAELSR
DLRKTCEEQTLSIPYNDYGDSKEI
Download sequence
Identical sequences ENSGGOP00000012101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]