SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012112 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012112
Domain Number 1 Region: 33-126
Classification Level Classification E-value
Superfamily Cystatin/monellin 1.32e-26
Family Cathelicidin motif 0.0000343
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012112   Gene: ENSGGOG00000012414   Transcript: ENSGGOT00000012459
Sequence length 170
Comment pep:known chromosome:gorGor3.1:3:49473293:49475403:1 gene:ENSGGOG00000012414 transcript:ENSGGOT00000012459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTQRDGHSLGWWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYRLLD
LDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGS
FDISCDKDNKRFALLGDFFRKAKEKIGKESKRIVQRIKDFLRNLVPRTES
Download sequence
Identical sequences Q1KLY3
ENSGGOP00000012112 ENSGGOP00000012112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]