SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012114 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012114
Domain Number 1 Region: 140-426
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.39e-101
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000274
Further Details:      
 
Domain Number 2 Region: 388-685
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.63e-83
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000813
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012114   Gene: ENSGGOG00000003702   Transcript: ENSGGOT00000012461
Sequence length 687
Comment pep:known_by_projection chromosome:gorGor3.1:18:8339685:8477998:1 gene:ENSGGOG00000003702 transcript:ENSGGOT00000012461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XKLAKKRKETMSSTRQEMTVMVNSMDKSYAEQGTNCDEAFSFMDTHNLNGRYLSSLDLYT
LFTTSLSCLLPISLSQDETVNLSKDLGAFAQAHCQTQSDIMGTVYRHETLHAAVSSSSFF
QENVGGMRGGEGDGWKRQRESFFEGQSAPWDSAKKDENRMKNRYGNIIAYDHSRVRLQTI
EGDTNSDYINGNYIDGYHRPNHYIATQGPMQETIYDFWRMVWHENTASIIMVTNLVEVGR
VKCCKYWPDDTEIYKDIKVTLIETELLAEYVIRTFAVEKRGVHEIREIRQFHFTGWPDHG
VPYHATGLLGFVRQVKSKSPPSAGPLVVHCSAGAGRTGCFIVIDIMLDMAEREGVVDIYN
CVRELRSRRVNMVQTEEQYVFIHDAILEACLCGDTSVPASQVRSLYYDMNKLDPQTNSSQ
IKEEFRTLNMVTPTLRVEDCSIALLPRNHEKNRCMDILPPDRCLPFLITIDGESSNYINA
ALMDSYKQPSAFIVTQHPLPNTVKDFWRLVLDYHCTSVVMLNDVDPAQLCPQYWPENGVH
RHGPIQVEFVSADLEEDIISRIFRIYNAARPQDGYRMVQQFQFLGWPMYRDTPVSKRSFL
KLIRQVDKWQEEYNGGEGRTVVHCLNGGGRSGTFCAISIVCEMLRHQRTVDVFHAVKTLR
NNKPNMVDLLDQYKFCYEVALEYLNSG
Download sequence
Identical sequences ENSGGOP00000012114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]