SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012134 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012134
Domain Number 1 Region: 18-144
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.21e-29
Family G proteins 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012134   Gene: ENSGGOG00000012436   Transcript: ENSGGOT00000012482
Sequence length 147
Comment pep:known_by_projection chromosome:gorGor3.1:17:42916584:43168551:1 gene:ENSGGOG00000012436 transcript:ENSGGOT00000012482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDYLCFRALCCKGPPPARPEYDLVCIGLTGSGKTSLLSKLCSESPDNVVSTTGFSIKAVP
FQNAILNVKELGGADNIRKYWSRYYQGSQGVIFVLDSASSEDDLEAARNELHSALQHPQL
CTLPFLILANHQDKPAARSVQERKNIL
Download sequence
Identical sequences ENSGGOP00000012134 ENSGGOP00000012134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]