SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012168 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012168
Domain Number 1 Region: 15-170
Classification Level Classification E-value
Superfamily EF-hand 1.68e-22
Family Calmodulin-like 0.0035
Further Details:      
 
Domain Number 2 Region: 406-468
Classification Level Classification E-value
Superfamily EF-hand 0.0000375
Family Calmodulin-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012168   Gene: ENSGGOG00000012467   Transcript: ENSGGOT00000012520
Sequence length 629
Comment pep:known_by_projection chromosome:gorGor3.1:1:65605279:65654820:1 gene:ENSGGOG00000012467 transcript:ENSGGOT00000012520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAISPRSDATFSSQKSTPSESPRTKKFPLTEEEIFYMNCRAAYLTVFKSSLENIISKDQL
YLALQHAGRNPSQKTINKYWTPQTAKLNFDDFCIILRKEKPTSKAELLKSFKQLDVNDDG
CILHTDLYKFLTKRGEKMTREEVNAIINLADVNADGKFDYIKFCKLYMTTNEQCLKTTLE
KLEVDSKLMRHQFGNHIEGSPERDPSPVPKPSPKITRKTDPETFSNKGDTRSSLLSATRK
FKTSVSFTVTMGANGNRNSKLTEPNLIKDWQHMQSKGCFFLEEDGEIISHQYRMQIAQRS
MVYLTIKPLNLSQVEGKPSPWLCVDTALYILKENESQANLQLVCFTELRNREVFGWTGEL
GPGIYWLIPSTTGCRLRKKIKPVTDEAQLVYRDETGELFLTKEFKSTLSDIFEVIDLDGN
GLLSLEEYNFFELRTSGEKCDEDAWAVCRENFDTKMNELTRQGFMDLNLMEANDREGDPC
DLWVTLHSMGYNKALELTEACPFVIDIYAEKCKPKIKAVHMEACSGQLEKAICKSVLSNG
DAKVMDGYENIIVHTYSCDTWITSVIENKSDEKVIIHINNELSKNCINNRGLNIFAVEVG
PKSTMVCQHVMPLNEQQEWIYYCIYSLIS
Download sequence
Identical sequences G3R9S4
ENSGGOP00000012168 XP_004025955.1.27298 ENSGGOP00000012168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]