SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012189 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012189
Domain Number 1 Region: 234-500
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.6e-79
Family Protein kinases, catalytic subunit 0.00000000139
Further Details:      
 
Domain Number 2 Region: 124-267
Classification Level Classification E-value
Superfamily SH2 domain 3.13e-37
Family SH2 domain 0.0000085
Further Details:      
 
Domain Number 3 Region: 64-149
Classification Level Classification E-value
Superfamily SH3-domain 7.08e-22
Family SH3-domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012189   Gene: ENSGGOG00000012490   Transcript: ENSGGOT00000012542
Sequence length 512
Comment pep:known_by_projection chromosome:gorGor3.1:8:53758326:53898863:1 gene:ENSGGOG00000012490 transcript:ENSGGOT00000012542 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCIKSKGKDSLSDDGVDLKTQPVRNTERTIYVRDPTSNKQQRPVPESQLLPGQRFQTKD
PEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAK
LNTLETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGSFSLSVRDFDPVHGDVI
KHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQADGLCRRLEKACISPKPQKPWDKDAW
EIPRESIKLVKRLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHD
KLVRLYAVVTREEPIYIITEYMAKGSLLDFLKSDEGGKVLLPKLIDFSAQIAEGMAYIER
KNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCF
TIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMTALSQGYRMPRVENCPDELYDIMKMCW
KEKAEERPTFDYLQSVLDDFYTATEGQYQQQP
Download sequence
Identical sequences G3R9U2 H2R453 P07948
ENSPTRP00000046608 ENSP00000428924 ENSGGOP00000012189 ENSPTRP00000046608 ENSP00000428924 ENSGGOP00000012189 9598.ENSPTRP00000046608 9606.ENSP00000376688 NP_002341.1.87134 NP_002341.1.92137 XP_004047066.1.27298 XP_528143.2.37143 ENSP00000428424 HR3089 gi|4505055|ref|NP_002341.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]