SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012191 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012191
Domain Number 1 Region: 25-81
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-21
Family HkH motif-containing C2H2 finger 0.0000797
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012191   Gene: ENSGGOG00000012499   Transcript: ENSGGOT00000012544
Sequence length 181
Comment pep:known_by_projection chromosome:gorGor3.1:6:35724639:35739908:1 gene:ENSGGOG00000012499 transcript:ENSGGOT00000012544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSASVDGHLSGCHLLFLFLSPLFRFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYY
QKWMEEQAQSLIDKTTAAFQQGKIPPTPFSAPPPAGAMIPPPPSLPGPPRPGMMPAPHMG
GPPMMPMMGPPPPGMMPVGPAPGMRPPMGGHMPMMPGPPMMRPPARPMMVPTRPGMTRPD
R
Download sequence
Identical sequences A0A2J8NYW0
ENSGGOP00000012191 ENSGGOP00000012191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]