SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012215 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012215
Domain Number 1 Region: 128-310
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-59
Family Phosphotyrosine-binding domain (PTB) 0.000000176
Further Details:      
 
Domain Number 2 Region: 475-587
Classification Level Classification E-value
Superfamily SH2 domain 9.83e-27
Family SH2 domain 0.0000183
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012215   Gene: ENSGGOG00000012520   Transcript: ENSGGOT00000012568
Sequence length 594
Comment pep:known_by_projection chromosome:gorGor3.1:9:70922840:71087721:-1 gene:ENSGGOG00000012520 transcript:ENSGGOT00000012568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPRTKYNRFRNDSVTSVDDLLHSLSVSGGGGKVSAARATPAAAPYLVSGKALRKAPDDG
PGSLGHLLHKVSHLKLSSSGLRGLSSAARERAGARLSGSCSAPSLAAPDGSAPSAPRAPA
MSAARKGRPGDEPLPRPPRGAPHASDQVLGPGVTYVVKYLGCIEVLRSMRSLDFSTRTQI
TREAISRVCEAVPGAKGAFKKRKPPSKMLSSILGKSNLQFAGMSISLTISTASLNLRTPD
SKQIIANHHMRSISFASGGDPDTTDYVAYVAKDPVNRRACHILECCDGLAQDVIGSIGQA
FELRFKQYLQCPTKIPALHDRMQSLDEPWTEEEGDGSDHPYYNSIPSKMPPPGGFLDTRL
KPRPHAPDTAQFAGKEQTYYQGRHLGDTFGEDWQQTPLRQGSSDIYSTPEGKLHVAPTGE
APTYVNTQQIPPQAWPAAVSSAESSPRKDLFDMKPFEDALKNQPLGPMLSKAASVECISP
VSPTAPDAKMLEELQAKTWYQGEMSRKEAEGLLEKDGDFLVRKSTTNPGSFVLTGMHNGQ
AKHLLLVDPEGTIRTKDRVFDSISHLINHHLESSLPIVSAGSELCLQQPVERKQ
Download sequence
Identical sequences ENSGGOP00000012215 ENSGGOP00000012215 XP_004048273.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]