SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012223 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000012223
Domain Number - Region: 151-333
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.0316
Family Amylase, catalytic domain 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012223   Gene: ENSGGOG00000012526   Transcript: ENSGGOT00000012576
Sequence length 744
Comment pep:known_by_projection chromosome:gorGor3.1:5:4030450:4044159:-1 gene:ENSGGOG00000012526 transcript:ENSGGOT00000012576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAAAVTVTRSATRRRRQRQLQGLAAPEAGTQEEQEDQEPRPRXXXXXXXIRDEEEETVF
REVVSFSPDPLPVRYYDKDTTKPISFYLSSLEELLAWKPRLEDGFNVALEPLACRQPPLS
SQRPRTLLCHDMMGGYLDDRFIQGSVVQTPYAFYHWQCIDVFVYFSHHTVTIPPVGWTNT
AHRHGVCVLGTFITEWNEGGRLCEAFLAGDERSYQAVADRLVQITQFFRFDGWLINIENS
LSLAAVGNMPPFLRYLTTQLHRQVPGGLVLWYDSVVQSGQLKWQDELNQHNRVFFDSCDG
FFTNYNWREEHLERMLGQAGERRADVYVGVDVFARGNVVGGRFDTDKSLELIRKHGFSVA
LFAPGWVYECLEKKDFFQNQDKFWGRLERYLPTHSICSLPFVTSFCLGMGARRVCYGQEE
AVGPWYHLSAQEIQPLFGEHRLGGDGRGWVRTHCCLEDAWHGGSSLLVRGVIPPEVGNVA
VRLFSLQAPVPPKIYLSMVYKLEGPTDVTVALELTTGDAGSCHIGGISVLNAETSSRHSL
RPLRVPPTKLARWVGRCGRQLSGGWVQHCYEVSLRGCLLLDLLVCFSRPPGSREEESFTC
RLGEIQVVDAASLLAPLPQVQAVTISHIRWQPSASEREGPPALLQLSCTLHWSFLLSQVR
CFRIHCWGGMSDDSPGRELPRPEMPMFLGLAFATQYRIVDLLVEAAGPGQYRRMEFLVEP
VPKEGFRVPQAEWGRAVLLYSAPA
Download sequence
Identical sequences ENSGGOP00000012223 ENSGGOP00000012223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]