SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012250 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012250
Domain Number 1 Region: 7-272
Classification Level Classification E-value
Superfamily Thiolase-like 2.43e-76
Family Thiolase-related 0.00000591
Further Details:      
 
Domain Number 2 Region: 274-394
Classification Level Classification E-value
Superfamily Thiolase-like 1.42e-43
Family Thiolase-related 0.0000355
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012250   Gene: ENSGGOG00000012552   Transcript: ENSGGOT00000012603
Sequence length 397
Comment pep:known_by_projection chromosome:gorGor3.1:18:47517166:47547763:-1 gene:ENSGGOG00000012552 transcript:ENSGGOT00000012603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETVDSVIMGNVL
QSSADAIYLARHVGLRVGIPKETPALTINRLCGSGFQSIVNGCQEICVKEAEVVLCGGTE
SMSQAPYYVRNVRFGTKLGSDIKLEDSLWVSLTDQHVQLTMAMTAENLAVKHKISREECD
KYALQSQQRWKAANDAGYFNDEMAPIEVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFK
KDGTVTAGNASGVADGAGAVIIASEDAVKKHNFTPLARIVGYFVSGCDPSIMGIGPVPAI
SGALKKAGLSLKDMDLVEVNEAFAPQYLAVERSLDLDISKTNVNGGAIALGHPLGGSGSR
ITAHLVHELRRRGGKYAIGSACIGGGQGIAVIIQSTA
Download sequence
Identical sequences G3RA00
XP_004059457.1.27298 ENSGGOP00000012250 ENSGGOP00000012250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]