SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012258 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012258
Domain Number 1 Region: 5-63
Classification Level Classification E-value
Superfamily HMG-box 0.0000000196
Family HMG-box 0.0057
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000012258
Domain Number - Region: 167-257
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0122
Family Calponin-homology domain, CH-domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012258   Gene: ENSGGOG00000012560   Transcript: ENSGGOT00000012612
Sequence length 437
Comment pep:known_by_projection chromosome:gorGor3.1:1:146151014:146186270:1 gene:ENSGGOG00000012560 transcript:ENSGGOT00000012612 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNRKASRNAYYFFVQEKIPELRRRGLPVARVADAIPYCSADWALLREEEKEKYAEMARE
WRAAQGKDSGPSEKQKPVFTPLRRPGMLVPKQNVSPPDMSTLSLKGDQALLGGIFYFLNI
FSHGELPPHCEQRFLPCEIGCVKYSLQEGIMADFHSFINPGEIPRGFRFHCQAASDSSHK
IPISNFERGHNQATVLQNLYRFIHPNPGNWPPIYCKSDDRTRVNWCLKHMAKASVMEEIR
QDLQLLTVEDLVVGIYQQKFLKEPSKTWIRSLLDVAMWDYSSNTRCKWHEENDILFCALA
VCKKIAYCISNSLATLFGIQLTEAHVPLQDYEASNSVTPKMVVLDAGRYQKLRVGSSGFS
HFNSSNEEQRSNTPIGDYPSGAKISGQNSSVRGRGITRLLESISNSSSNIHKFSNCDTSL
SPYMSQKDGYKSFSSLS
Download sequence
Identical sequences ENSGGOP00000012258 ENSGGOP00000012258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]